KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148: BN148_0349Help
Entry
BN148_0349        CDS       T02302                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cjb  Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
Pathway
cjb00260  Glycine, serine and threonine metabolism
cjb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cjb01100  Metabolic pathways
cjb01110  Biosynthesis of secondary metabolites
cjb01130  Biosynthesis of antibiotics
cjb01230  Biosynthesis of amino acids
Module
cjb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cjb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BN148_0349 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BN148_0349 (trpA)
Enzymes [BR:cjb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BN148_0349 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB PucR IGPS FMN_dh
Motif
Other DBs
NCBI-ProteinID: CCK66477
Structure
PDB: 

Jmol
Position
320000..320749
Genome map
AA seq 249 aa AA seqDB search
MVDFRKFYKENANVAYTVLGYPNLQTSEAFLQRLDQSPIDILELGVAYSDPIADGEIIAD
AAKIALDQGVDIHSVFELLARIKTKKALVFMVYYNLIFSYGLEKFVKKAKSLGICALIVP
ELSFEESDDLIKECERYNIALITLVSVTTPKERVKKLVKHAKGFIYLLASIGITGTKSVE
EAILQDKVKEIRSFTNLPIFVGFGIQNNQDVKRMRKVADGVIVGTSIVKCFKQGNLDIIM
KDIEEIFKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggttgattttagaaaattttataaagaaaatgcaaatgtggcttatacggttttaggt
tatccaaatcttcaaacaagtgaagcttttttgcaaagattggatcaaagtcctattgat
attttagaacttggtgttgcttatagtgatcctattgccgatggtgagattattgcagat
gcggcaaaaatagctcttgatcaaggcgtggatattcatagtgtttttgagcttttagct
aggataaaaactaaaaaagctttggtttttatggtttattataatttaattttttcttat
ggcttggaaaaatttgtgaaaaaagcaaaatctttagggatttgtgctttgattgtgcct
gaattgagttttgaagaaagtgatgatttgattaaagagtgtgaaagatataatatagct
ttaatcacacttgtaagcgttacaacccctaaagaaagggttaaaaagttggtaaaacat
gctaaaggttttatttatttattagcaagtataggtattacaggtacaaaaagtgtcgaa
gaagcaatcttacaagataaagtaaaagaaatcagatcttttacaaatttgcctattttt
gtaggttttggcattcaaaataatcaagatgtaaaaagaatgagaaaagttgctgatgga
gtgattgtgggaactagcatagtaaagtgttttaaacaaggaaatttggatataataatg
aaagatattgaagaaattttcaaaaaataa

DBGET integrated database retrieval system