KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148: BN148_0358Help
Entry
BN148_0358        CDS       T02302                                 

Definition
cytochrome C551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cjb  Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
Brite
Enzymes [BR:cjb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BN148_0358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
326024..327049
Genome map
AA seq 341 aa AA seqDB search
MKVKSLLIASLVAFSSLNAASLIDEAKNSGLVALPKDQKGVDEILKQNGVKASEFTLEKA
ELGKKLYFEPRLSKSGIISCNTCHNVGLGGTDGISTAIGHKWTANPHHLNSPTVYNAVLN
NTQFWDGRAGTLADQAKGPIQADPEMATPAKLAVEKISSLPEYVSEFKKIYGKSGVNFDN
IADAIANFERTLITPSRFDKFLEGDEKALTKEEQKGLKLFIDKGCVACHNGVNLGGNMQA
FEVAGKYKFANLGDFKGDANGMVKTPTLRNVAETAPYFHNGAIWNLKDAIKEMGSVQLGI
KISDKEAKSIETFLKSLTGTKPAIVYPQLPISTEKTPKPEL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaatcattgctaatcgcatccttagttgctttttcaagcttaaatgctgca
agtcttatagatgaagctaaaaattcaggtcttgttgccttaccaaaagatcaaaaaggc
gttgatgaaattttaaaacaaaatggagtaaaggctagtgaatttactcttgaaaaagca
gagcttggcaaaaagctctattttgaaccacgtctttcaaaaagtggtatcatttcttgt
aatacctgtcataatgtaggacttggtggaacagatggaatcagtactgcaataggtcat
aaatggacagcaaatcctcatcatttaaattcaccaacagtttataatgcagttttaaat
aatactcaattttgggatggtcgtgcaggaacattagccgatcaagctaaaggtccaatc
caagctgatcctgaaatggcaactcctgctaaacttgcagtagaaaaaatttcatctttg
cctgaatatgtgagtgagtttaaaaaaatctatggtaaaagcggtgtaaattttgacaat
attgctgatgcaattgcaaattttgaaagaactttgatcactccatctcgttttgataaa
tttttagaaggcgatgaaaaagctttaacaaaagaagaacaaaaaggcttaaagcttttt
atagataaaggttgtgtagcttgtcataatggtgtgaatttaggtggcaatatgcaagcg
tttgaagttgctggtaaatataaatttgcaaatttaggtgattttaaaggtgatgcaaat
ggcatggtaaaaactccaactttaagaaatgttgctgaaactgctccatattttcataat
ggtgcgatttggaatttaaaagatgctattaaggaaatgggtagtgtgcaacttggcatt
aaaatttctgataaagaagcaaaaagtattgaaactttcttaaaatctttaacaggaaca
aaaccagcaattgtttatccacaacttcctatttctactgaaaaaactcctaaacctgaa
ctataa

  All links  
No link information was found.   
DBGET integrated database retrieval system