KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148: BN148_0799cHelp
Entry
BN148_0799c       CDS       T02302                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cjb  Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cjb03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(749307..749858)
Genome map
AA seq 183 aa AA seqDB search
MVVGIEGIITKKEPTFIIVKCASGLSYGIFISLFCSAKIQTQEKHEFFITQIIKEDSNKF
YGFLDKDEQKMFEMLLKVNGVGANTAMAVCSSLDVNSFYKALSLGDESVLKKVPGIGPKS
AKRIIVELSDTKTKLENVSDDKSEALAALLTLGFKQEKIISVLVSAQATGTSELIKEALK
KLG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcggcatcgaaggaataatcacaaaaaaagaacctacttttatcattgttaaa
tgtgctagtggtttaagctatgggatatttatttctcttttttgttctgctaaaattcaa
actcaagaaaagcatgagttttttatcactcaaatcatcaaagaagattctaataaattt
tatggcttcttggataaagatgaacaaaaaatgtttgaaatgcttttaaaagtcaatgga
gtgggtgcaaatactgctatggcggtatgctctagtcttgatgtaaattctttttacaaa
gcgttaagtttgggcgatgaaagcgtgcttaaaaaagtacctggcataggtccaaaaagt
gcaaaacgcattatagtagaactttctgacacaaaaaccaaacttgaaaatgtaagcgat
gataaaagcgaagccttagccgcacttcttactctaggctttaaacaagaaaaaatcata
agtgttttagtaagtgctcaagcaacaggcacaagcgaactcatcaaagaagctcttaaa
aaactaggataa

DBGET integrated database retrieval system