KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148: BN148_0924cHelp
Entry
BN148_0924c       CDS       T02302                                 

Gene name
cheB'
Definition
MCP protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cjb  Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cjb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BN148_0924c (cheB')
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BN148_0924c (cheB')
Enzymes [BR:cjb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BN148_0924c (cheB')
Two-component system [BR:cjb02022]
 CheA family
  CheA-CheYBV
   BN148_0924c (cheB')
Bacterial motility proteins [BR:cjb02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BN148_0924c (cheB')
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(859567..860121)
Genome map
AA seq 184 aa AA seqDB search
MKLILIGSSTGGPNQLKFLLKDIDVKNTCVVIAQHMSASFIPSFVGQFNKEAFSEVCLLN
DKEILSNKIYICPKNTILSGNLNIVAAWQDVASSFKPSVDLLFHSAVSLAKTNKILAIIL
TGMGDDGAKGLFELYKTGVRCLCENEADSVVYGMPKRAKDMNPHLKPMSLKEIKKEIVNF
IDQD
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctcatactcataggatcttcaacaggtggtcctaatcagcttaaatttctttta
aaggatattgatgtaaaaaatacttgtgtagttatagctcagcacatgagtgccagtttt
attccatcttttgtggggcaatttaataaagaagcttttagtgaagtgtgcttattgaac
gataaagagatattaagcaataaaatttatatttgccctaaaaatactattttatctgga
aatttaaatattgtagccgcttggcaagatgtggcttcaagctttaaaccgagtgtggat
ttactttttcattccgctgtttctttggcaaaaacaaataaaatacttgctattatttta
acgggcatgggagatgatggcgcaaaaggtttatttgagctttataaaacaggagttaga
tgtttatgtgagaatgaagcagatagcgtcgtttatggtatgccaaaaagagcaaaagat
atgaatccgcatttaaaacctatgagcttaaaagaaattaaaaaagaaattgtaaatttt
attgatcaggattaa

DBGET integrated database retrieval system