KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148: BN148_0924cHelp
Entry
BN148_0924c       CDS       T02302                                 

Gene name
cheB'
Definition
MCP protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cjb  Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cjb02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cjb02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(859567..860121)
Genome map
AA seq 184 aa AA seqDB search
MKLILIGSSTGGPNQLKFLLKDIDVKNTCVVIAQHMSASFIPSFVGQFNKEAFSEVCLLN
DKEILSNKIYICPKNTILSGNLNIVAAWQDVASSFKPSVDLLFHSAVSLAKTNKILAIIL
TGMGDDGAKGLFELYKTGVRCLCENEADSVVYGMPKRAKDMNPHLKPMSLKEIKKEIVNF
IDQD
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctcatactcataggatcttcaacaggtggtcctaatcagcttaaatttctttta
aaggatattgatgtaaaaaatacttgtgtagttatagctcagcacatgagtgccagtttt
attccatcttttgtggggcaatttaataaagaagcttttagtgaagtgtgcttattgaac
gataaagagatattaagcaataaaatttatatttgccctaaaaatactattttatctgga
aatttaaatattgtagccgcttggcaagatgtggcttcaagctttaaaccgagtgtggat
ttactttttcattccgctgtttctttggcaaaaacaaataaaatacttgctattatttta
acgggcatgggagatgatggcgcaaaaggtttatttgagctttataaaacaggagttaga
tgtttatgtgagaatgaagcagatagcgtcgtttatggtatgccaaaaagagcaaaagat
atgaatccgcatttaaaacctatgagcttaaaagaaattaaaaaagaaattgtaaatttt
attgatcaggattaa

DBGET integrated database retrieval system