KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148: BN148_1048cHelp
Entry
BN148_1048c       CDS       T02302                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cjb  Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
Pathway
cjb00300  Lysine biosynthesis
cjb01100  Metabolic pathways
cjb01120  Microbial metabolism in diverse environments
cjb01230  Biosynthesis of amino acids
Module
cjb_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cjb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BN148_1048c (dapE)
Enzymes [BR:cjb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     BN148_1048c (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42 Peptidase_M18 KNTase_C
Motif
Other DBs
NCBI-ProteinID: CCK67143
Position
complement(980554..981651)
Genome map
AA seq 365 aa AA seqDB search
MNAKEFLIELLKFKSVTPNDDGALNFIAMELSDFEAFFIEKEGIKNLLLTKKFKDEGEHL
AFGGHVDVVPAGEGWSNNAFAPVEKEGFIYARGAQDMKSGVAAFVDAAKNADFKGARLSL
ILTSDEEGEAIYGTKAVLEWMQERDMLPDYAVVAEPTCVKKIGDSIKIGRRGSINGKLLI
RGKQGHVAYPEKCINPVHDFAPVLKLLAGFDLDPGSAEFSPSKIVITDIRGGMGVCNVTP
NDLKLMFNVRNSPDTSLEDVKSYVEKICHGLNYELELKQSSEAFLTNIDNKIVQKMNESV
QKITHEVPELNTKGGTSDARYFAKYGVKVVEFGVCNDRIHAIDERVSIEEFEKLCLVFKD
LIENF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaaagaatttttaatcgaacttttaaaatttaaatctgttacgccaaatgat
gatggagctttaaatttcatcgctatggaactgagtgattttgaagctttttttatagaa
aaagaaggcattaaaaaccttttactcactaaaaaatttaaagatgaaggcgagcattta
gcttttggtgggcatgtagatgtggtgcctgcaggcgagggttggagtaataatgctttt
gcgcctgtggaaaaagaaggctttatctatgcaaggggtgctcaagatatgaaaagcgga
gtagcagcctttgtggatgcggcaaagaatgcggattttaaaggagcaagactgagtctt
attttaacaagtgatgaagaaggcgaggctatatatggaaccaaggctgttttagaatgg
atgcaagaaagagatatgttacctgattatgccgtggttgcagagccaacctgtgttaaa
aaaatcggcgatagtattaaaatagggcgtcgtggttctatcaatggaaaacttttaatc
cgtggaaaacaagggcatgttgcttatcctgaaaaatgtatcaatcctgtgcatgatttt
gcaccggttttaaagcttttagcgggttttgatcttgatcctggaagtgctgaatttagt
ccttcaaaaatcgttataactgatattcgtggaggtatgggggtatgtaatgtaacgcca
aatgatttaaaacttatgtttaatgtacgcaattcccctgatacaagcttagaagatgta
aaaagttatgtagaaaaaatttgtcatggtttaaactatgagttagagctaaaacaatca
agcgaagcttttttgacaaatatcgataataaaatcgttcaaaaaatgaatgaaagcgtt
caaaaaatcactcatgaagtgccagagcttaataccaaaggcggtacaagtgatgcaagg
tattttgcaaaatacggtgtaaaggtagtagaatttggggtttgtaatgatagaattcac
gctattgatgaaagagtaagcatagaagaatttgaaaaactttgccttgtttttaaagac
ttgatagaaaatttttaa

DBGET integrated database retrieval system