KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148: BN148_1098Help
Entry
BN148_1098        CDS       T02302                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cjb  Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BN148_1098 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BN148_1098 (pyrB)
Enzymes [BR:cjb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BN148_1098 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1032186..1033073
Genome map
AA seq 295 aa AA seqDB search
MRHLITTKDFNKVEIMELFKEASDFLDEKPRTFLEGKSITTIFFENSTRTLSSFESAARR
LGARVLRLDVSRSSSSKGETLYDTAANLDAMSPNAIVVRHANSGVPLILAKHMHCPVVNG
GDGKHAHPTQALLDLFTIYNHFQGNVEGKKICIVGDIKNSRVAASNIELLSRFNLDITLV
APPHFMPNTHLKKHYKLDENIIANSDIIMSLRTQTERHNKTVYASLKDYANDFCIQKSLV
KDKKLILLHPGPVNRNIDISDEMMSNERTLVLKQVKNGVAIRMAVLKKLILENEG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatctcatcactacaaaggattttaataaagtcgaaattatggagctttttaaa
gaagcaagtgatttcttagatgaaaaacctaggacttttcttgaaggaaaaagcatcacg
acaattttttttgaaaactctacacgcaccctttcatcttttgaaagcgctgcaagaaga
ttaggtgctagggttttacgccttgatgtttcaagatcaagctctagcaaaggagaaact
ctttatgatactgctgctaatttagatgccatgagtcctaatgctattgttgtaagacac
gcaaactcaggagttcctttgatattagcaaagcatatgcattgtccagttgttaatgga
ggagatggaaaacacgcccatcctacccaagctttactcgatttgtttacgatttataat
cattttcaaggtaatgttgaaggtaagaaaatttgcatcgtaggtgatatcaaaaattcc
cgcgttgcagcgtccaatatagagcttttaagtagatttaatcttgatattaccctagta
gctccaccacattttatgcctaatacccatcttaaaaaacattataagcttgatgagaat
atcatagcaaattcagatattatcatgagtcttagaacacaaacagaaagacataataaa
accgtttatgcttcacttaaagactatgcaaatgatttttgcattcaaaaaagcttagta
aaggataaaaagcttattttactacatccaggccctgtaaatcgcaatattgacataagc
gatgaaatgatgagcaatgaaaggactttagttttaaaacaagttaaaaatggagtggct
attagaatggctgttcttaaaaaactcatactagaaaatgaaggataa

DBGET integrated database retrieval system