KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148: BN148_1407cHelp
Entry
BN148_1407c       CDS       T02302                                 

Definition
phospho-sugar mutase (EC:5.4.2.-)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cjb  Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cjb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN148_1407c
   00030 Pentose phosphate pathway
    BN148_1407c
   00051 Fructose and mannose metabolism
    BN148_1407c
   00052 Galactose metabolism
    BN148_1407c
   00500 Starch and sucrose metabolism
    BN148_1407c
   00520 Amino sugar and nucleotide sugar metabolism
    BN148_1407c
  Nucleotide metabolism
   00230 Purine metabolism
    BN148_1407c
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BN148_1407c
Enzymes [BR:cjb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     BN148_1407c
    5.4.2.8  phosphomannomutase
     BN148_1407c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1339759..1341147)
Genome map
AA seq 462 aa AA seqDB search
MNLKEKMLDVIFREYDIRGLYDKELNEKSVKAIGFCLGQTMLNRGCKNVSVGYDARYSAN
ELFNYLVSGLNKAGIKIYDIGLVPTPLGYFSLYEGLKFDANVMITGSHNPKDYNGFKITI
NKESFFGVELKEFSKEVYKHLDDDIEENLEVEKYDILNLYVKFMCEQFSFLKDFNYKFGV
DCTNGAAGVVIKPLIKALNLKAHVMFAEPDGQFPNHAPDPTEEENLSAIREFLNQNQDYS
LAFAFDGDADRMVALSKTHVFCGDELCYLFAKDIPNPRILGEVKCSKNLFDEVAKFGTIF
MGKTGHSNIKKMMKEKDIDLAAEVSGHIFFKHRYFGYDDGIYAFLRALELVYKGFDLESM
IKALPKLYTTPEIKIPVNEEEKFKLVEEFQKEIEKGALKGVKSLCEIDGARIDFGDGWAL
LRASNTSPYLITRFEATSLERAKELESMVFTLFNDIKARFKN
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgaaggaaaaaatgttagatgtgatttttagagaatatgatataagaggactt
tacgacaaagaattgaatgaaaaaagcgttaaagctataggtttttgtttgggacaaact
atgttaaataggggttgtaaaaatgtaagcgtgggctatgatgcaagatatagtgcaaat
gaactttttaattatctagtgagtggacttaacaaagcgggaataaaaatctatgatata
gggcttgtaccaactccattgggatattttagtctttatgagggcttaaaatttgatgca
aatgttatgataacaggctctcataacccaaaagattataatggttttaaaattactatc
aataaagaaagtttttttggtgtagaattaaaagagttttcaaaagaagtttataagcat
ttagatgatgatattgaagaaaatttagaagtagaaaaatacgatattttaaacctttat
gtgaaatttatgtgcgagcaatttagctttttaaaggattttaattataaatttggtgtt
gattgcacaaatggtgcggctggagtggtgataaagcctttaatcaaggctttaaattta
aaagctcatgtaatgtttgcagagcccgatggacagtttccaaaccatgctccagatcct
acagaagaagaaaacttaagtgcgattagagaatttttaaatcaaaatcaagattattct
ttggcttttgcttttgatggggatgctgatagaatggttgctttaagtaaaactcatgta
ttttgtggggatgagctttgttatttgtttgctaaagatatccctaatccacgcatttta
ggtgaggtaaaatgttctaaaaatctttttgatgaagtggctaaatttggaactattttt
atgggaaaaacaggacattctaatatcaaaaaaatgatgaaagaaaaagatattgattta
gctgctgaagtgagtgggcatattttctttaaacatagatattttggttatgatgatgga
atttatgcatttttaagagccttggagcttgtttataaaggttttgatctagaaagtatg
attaaagctttaccaaaactttatactacacctgaaattaaaattcctgtaaatgaagaa
gaaaaattcaaacttgtggaagaatttcaaaaagagattgaaaaaggagctttaaaaggt
gttaaaagtctttgtgaaattgatggagctaggatagattttggcgatggatgggcttta
cttcgtgcatctaataccagcccttatcttatcacacgctttgaggcaacatctttagaa
agagcaaaagagcttgaaagtatggtatttactttgtttaatgatataaaagctagattt
aagaattga

DBGET integrated database retrieval system