KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148: BN148_1430cHelp
Entry
BN148_1430c       CDS       T02302                                 

Gene name
rfbC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cjb  Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
Pathway
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:cjb00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1364126..1364671)
Genome map
AA seq 181 aa AA seqDB search
MAIEFDIQESKILKGVYIITPNKFRDLRGEIWTAFTDEYLSKLVPDGIKFKHDKFINSHF
NVLRGIHGDVKTYKLVTCVYGEVHQVVVDCRKDSPTYLKWEKFIISYKNQQLILLPPNMG
NSHYVSSKEAVYYYKLAYEGEYMDAPDQFTYAWNDERIGIDWPTNTPILSDRDILATKNK
G
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagaatttgatatacaagaatcaaaaattttaaaaggagtgtatattataact
cctaataaatttagagatttaagaggtgaaatttggacagcttttacagatgaatattta
agcaagttggttccagatggaattaaatttaagcatgacaaatttataaattcccatttt
aatgttttacgtggaatacacggagatgtgaaaacttacaaacttgtaacttgtgtctat
ggagaagtgcatcaagttgtggttgattgcagaaaagattccccaacttatttaaaatgg
gagaaatttattataagttataaaaatcagcaacttattttattaccaccaaatatggga
aattctcattatgtgagttcaaaggaagcagtgtattattataaacttgcttatgagggg
gaatatatggatgcacctgatcaatttacttatgcatggaatgatgaaagaattggtata
gattggccaacaaatacgcctattctttccgatcgcgatattcttgcaactaaaaataaa
ggataa

DBGET integrated database retrieval system