KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100399741Help
Entry
100399741         CDS       T03264                                 

Gene name
ABHD6
Definition
(RefSeq) abhydrolase domain containing 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    100399741 (ABHD6)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100399741 (ABHD6)
Peptidases [BR:cjc01002]
 Serine Peptidases
  Family S33
   100399741 (ABHD6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr DUF1057 FSH1 BAAT_C Lipase DLH Esterase DUF2048 Thioesterase
Motif
Other DBs
NCBI-GeneID: 100399741
NCBI-ProteinID: XP_002758536
Ensembl: ENSCJAG00000019753
UniProt: F6R5U3
Position
15
AA seq 337 aa AA seqDB search
MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQF
CYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLICVDMPGHEGTTRSSLDDLS
IDGQVKRIHQFVECLKLNKKPFHLIGTSMGGHVAGVYAAYYPSDVSSLCLVCPAGLQYST
DNQFIQRLKELQDSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHN
NFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVEL
LENCGHSVVMERPRKTAKLIVDFLASVHNTDNNKKLD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgatgtggttaacatgtttgtgattgcgggcgggacactggccatccctatc
ctggcattcgtagcctcatttctcctgtggccttcagcactgataagaatctattattgg
tactggcggaggacattgggcatgcaagtccgctatgttcaccatgaagactatcagttc
tgttattccttccggggcaggcctggccacaaaccctccatcctcatgctccacggattc
tctgcacacaaggatatgtggctcagtgtggtcaagttccttccaaagaacctgcacttg
atctgcgtggacatgccaggacatgagggcactacccgttcctccctggatgacctgtcc
atagatgggcaagtcaagaggatacaccagtttgtagaatgcctcaagctgaacaaaaaa
cctttccacctgataggcacctccatgggtggccacgtggctggggtgtatgctgcttac
tacccgtcagatgtctccagcctttgtcttgtgtgtcctgctggcctgcagtactcaact
gataatcagttcatacaacggctcaaagaactgcaggactctgccgccgtggagaagatt
cccttgatcccgtctaccccagaagagatgagcgaaatgcttcagctctgctcctatgtc
cgcttcaaggtgccccagcagatcctgcaaggccttgttgatgtccgcatccctcataac
aacttctaccgaaagctgtttttggaaatcgtcagtgagaagtccagatactctctccat
cagaacatggacaagatcaaggtcccgacgcagatcatctggggaaaacaagaccaggtg
ctagatgtgtctggggcggacatgttggccaagtcaattgccaattgccaggtggagctt
ctggaaaactgtgggcactcggtagtgatggagagacccaggaagacagccaagctcatc
gtcgactttttagcttctgtgcacaacacagacaacaacaagaagctggactga

DBGET integrated database retrieval system