KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_0075Help
Entry
JJD26997_0075     CDS       T00573                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cjd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(82807..83280)
Genome map
AA seq 157 aa AA seqDB search
MLKIQGAKYFEKSRFFPFFSQNIRSFKYLALIGLGSNIEPEKKRFDMLFRAMMDDKRFKI
LSTSPMLINEAFGFKEQKDFTNAVMLIQTNLHARALLKVLLYYEVKFKRKRTFKYAPRTL
DLDLLYFSQKVKRDKWCEVPHKEAKERVSVILPLGMI
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaattcaaggagcaaaatactttgaaaaaagtcgtttttttcctttttttagt
caaaatatacgatcttttaaatatttagcccttatagggttaggaagcaatatagagccc
gaaaaaaaaagatttgatatgctttttcgagcaatgatggatgataaaagatttaaaatt
ttatccacatctcctatgttgatcaatgaagcctttggttttaaagagcaaaaagatttt
accaatgctgttatgttgatacaaactaatttgcatgcacgagcacttttgaaagtttta
ctttattatgaagtaaaatttaaacgcaagagaactttcaaatacgctcctagaacgctt
gatttagatcttttatacttttcacaaaaagtcaagcgtgataagtggtgtgaggtgcct
cataaagaggctaaagaaagagtgagtgtaattttgcctttaggcatgatataa

DBGET integrated database retrieval system