KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_0364Help
Entry
JJD26997_0364     CDS       T00573                                 

Gene name
dxr
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.-)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JJD26997_0364 (dxr)
Enzymes [BR:cjd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     JJD26997_0364 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
317309..318379
Genome map
AA seq 356 aa AA seqDB search
MILFGSTGSIGVNALKLAALKNIPISALACGDNIALLNEQIARFKPQFVAIKDSKNKHLV
KHDRVFIGQEGLEQILTECQDRLLLNAIVGFAGLKSTLKAKELGKNIALANKESLVVAGS
FLKGAKFLPIDSEHVALKFLLEGKKNIAKLYITASGGAFYKYKIKDLNQVSVKDALKHPN
WNMGAKITIDSATMANKLFEIIEAYHLYDFKESDALIEPRSLVHAMCEFKNGASTAYFSK
ADMKLAISDAIFEKQDTPILEAVDFSKMPALKFHKISTKKYPIFKLKNAFLKEPNLGVII
NAANEVGVYNFLENKSGFLDIAQCIFKALDHFGAPKISSIEEVFEYDFKTREYLRS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgatactttttggaagtacgggtagtataggagtgaatgctcttaaacttgctgcttta
aaaaacattcccatttctgctttagcttgtggggataacatcgctcttttaaatgaacaa
atcgcaaggtttaagccccaatttgttgccataaaagattcaaaaaataagcatttagtt
aaacacgatagagtttttatagggcaagaaggtttagagcaaattttaacagaatgccaa
gacaggcttttgctcaatgccattgtaggttttgcagggcttaaaagcactttaaaggcc
aaagaacttggcaaaaacatagccttagccaacaaagaaagccttgtggtggcggggagt
tttttaaaaggggctaaatttttacccattgatagtgagcatgtggctttaaaattttta
ctcgaaggtaaaaaaaatatagcaaaactttatatcacagcaagtggtggagctttttat
aagtataaaatcaaagatttaaatcaagtcagtgtcaaagacgctttaaaacatcctaat
tggaacatgggagcaaagatcactatagatagtgcgactatggcaaataagctttttgag
attatagaggcttatcatttatatgattttaaagaaagtgatgctttaatagaaccaaga
tctttagtgcatgcaatgtgtgaatttaaaaatggagctagcacggcgtatttttcaaaa
gcagatatgaaactagctatttcagatgctatatttgaaaaacaagatacgcctatttta
gaagctgttgattttagtaaaatgcctgctttaaaatttcataaaattagcacaaaaaaa
tatcctatttttaaacttaaaaatgcatttttaaaagagccaaatttaggggttatcatc
aatgctgctaatgaagttggcgtttataatttcttagaaaataaaagtggatttttagat
attgctcaatgtattttcaaagctcttgatcattttggagcgcctaaaatttcaagcata
gaagaagtttttgagtatgattttaaaacaagagagtatttaaggagttaa

DBGET integrated database retrieval system