KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_0461Help
Entry
JJD26997_0461     CDS       T00573                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
cjd03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    JJD26997_0461 (recR)
DNA repair and recombination proteins [BR:cjd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     JJD26997_0461 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      JJD26997_0461 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecR Toprim_4 zn-ribbon_14 Ras_bdg_2
Motif
Other DBs
NCBI-ProteinID: ABS43869
UniProt: A7H2B7
Position
complement(409991..410563)
Genome map
AA seq 190 aa AA seqDB search
MAKGLEKFNELVESFANLPTIGKKTAIRLAYHLCINNQIDGMKLAHNIENAIRFIKPCEQ
CGALSENELCEICSDEERSKNILCIVESPKDILTLEESQSYNGLYFVLDELNEEKLEKLK
QILLKLNISELIFALTHSINSDATIFFIEDKFKDLNLTFSKIAQGIPSGVNLENVDLISL
NKAMNFRTKI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggcctagaaaaattcaatgaacttgttgaaagttttgcaaatttacctacc
ataggaaaaaaaaccgctataagacttgcttatcacctttgcataaataatcaaatcgat
ggtatgaaactcgcacacaatatagaaaatgctatccgctttataaaaccttgtgagcaa
tgtggtgctttaagtgaaaatgagctttgtgaaatttgtagcgatgaagaaagaagtaaa
aatattttatgtatagttgaaagcccaaaagatatactaacgctcgaagagagtcaaagt
tacaatgggctatattttgttttagatgagttaaatgaagaaaaacttgaaaaactaaag
caaatcctacttaagctaaatatctctgagctcatttttgcattgacacatagcattaat
tctgatgcaaccatcttttttatagaagataaatttaaagacttaaacctaacttttagt
aaaatcgctcaaggaattccaagtggtgtaaatttagaaaatgtggatttaatctcttta
aataaagctatgaattttagaacaaaaatttag

DBGET integrated database retrieval system