KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_0552Help
Entry
JJD26997_0552     CDS       T00573                                 

Definition
(GenBank) putative guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
cjd00230  Purine metabolism
cjd01100  Metabolic pathways
Module
cjd_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    JJD26997_0552
Enzymes [BR:cjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     JJD26997_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 ABC_tran AAA_33 RsgA_GTPase MMR_HSR1 AAA_22 Rad17 AAA_29 AAA_14 KAP_NTPase NTPase_1 Thymidylate_kin RNA_helicase AAA NACHT AAA_17 ATPase_2 NB-ARC cobW CSF-1 RepB-RCR_reg T2SSE AAA_30 Cytidylate_kin Methyltransf_12 AAA_24 Zeta_toxin Viral_helicase1 TsaE APS_kinase AAA_28
Motif
Other DBs
NCBI-ProteinID: ABS43856
UniProt: A7H2J7
Position
500005..500622
Genome map
AA seq 205 aa AA seqDB search
MQGFVLLISGPSGAGKSTLLKKLFDEFEDELYFSISSTTRKPREGEKNGIHYHFISHEEF
QKGIDSDHFLEWAKVHENFYGTSLKHTQDALDNGKIVVFDIDVQGFKIARQKMADKIVSV
FITTKNKDELKKRLIKRNTDTIIQLEKRLQNASDEMKELSEYDYLIINNELKQSYEALRA
ILIAYKFRTKGQNLGQIQNIWNEGE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaggttttgttttgttgatttcaggtcctagtggtgctggaaaatcaactctttta
aaaaaactttttgatgaatttgaagatgagctttatttttctatttcttcaacaactcgc
aaaccaagagagggtgaaaaaaatggaatacattatcattttatatcccatgaagaattt
caaaaaggtatagatagtgatcattttttagaatgggctaaggtgcatgaaaatttttat
ggcacttctttaaagcacactcaagatgctttagataatggaaaaatagttgtttttgat
attgatgtgcaaggatttaaaatagccagacaaaaaatggctgataagattgtttctgtt
tttattactacaaaaaataaagatgagctaaaaaaaagacttattaagcgaaatactgat
acaataatacaactagaaaaaagattacaaaacgctagcgatgaaatgaaagagcttagc
gagtatgattatcttatcattaataatgagttaaagcaaagttatgaagcattgcgagcg
attttaatcgcctataaatttagaaccaaagggcagaatctagggcaaattcaaaatatt
tggaatgaaggagaataa

DBGET integrated database retrieval system