KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_0618Help
Entry
JJD26997_0618     CDS       T00573                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JJD26997_0618 (ispE)
Enzymes [BR:cjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     JJD26997_0618 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(557758..558525)
Genome map
AA seq 255 aa AA seqDB search
MKAYAKANIFLKLTGFDSRKYHLLESRFILLKDVFDELELVDKESDSKKEFEIISNFKCE
NNIIQKAYLLLSRRYNNELKELFSKKSLKLTKNIPVCAGLGGGSSDCASFLLLMNETLNL
KLNLQELINLSIQLGSDIAFFLSGFNSANVSGCGEIIEEFEDDIPTLKWTFPQISCQTKA
VYDEFDREIFDFQKNNNQAQIYKKLSTKELLQNFKNKELNDLFTPCATLYPKMKSYLQED
FFLSGSGSSVFKVDR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttacgctaaagcaaatatttttttaaaacttaccggttttgactcaagaaaa
tatcatcttttagaatcacgattcatacttttaaaagatgtttttgatgagcttgagctt
gttgataaagaatcagattctaaaaaagaatttgaaatcattagtaattttaaatgcgaa
aataatattattcaaaaggcttatttgctactttctagaagatataataacgaattaaaa
gaattatttagcaaaaaaagcctaaaactcacaaaaaatatccccgtatgtgctgggctt
ggtggtggaagtagcgattgtgcgagttttttgctactaatgaatgaaaccttaaatttg
aaattaaacctgcaagaacttataaatttaagcatacaactaggaagtgatattgctttt
tttttaagtggctttaattctgctaatgtaagtggctgtggcgaaattatagaagaattt
gaagatgacatacccactttaaaatggacttttccacaaatatcttgccaaactaaagct
gtttatgatgaatttgatagagaaatatttgactttcaaaaaaacaacaatcaagcgcaa
atctacaaaaaactcagtacaaaagagttattacaaaactttaaaaacaaagaattaaat
gatttatttactccttgtgcaactttatatcctaaaatgaagtcttatttacaagaagat
ttttttctaagcggtagcggtagtagtgtttttaaggttgatcgatga

DBGET integrated database retrieval system