KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_0618Help
Entry
JJD26997_0618     CDS       T00573                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
cjd00900  Terpenoid backbone biosynthesis
cjd01100  Metabolic pathways
cjd01110  Biosynthesis of secondary metabolites
cjd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    JJD26997_0618 (ispE)
Enzymes [BR:cjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     JJD26997_0618 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABS43498
UniProt: A7H2Q3
Position
complement(557758..558525)
Genome map
AA seq 255 aa AA seqDB search
MKAYAKANIFLKLTGFDSRKYHLLESRFILLKDVFDELELVDKESDSKKEFEIISNFKCE
NNIIQKAYLLLSRRYNNELKELFSKKSLKLTKNIPVCAGLGGGSSDCASFLLLMNETLNL
KLNLQELINLSIQLGSDIAFFLSGFNSANVSGCGEIIEEFEDDIPTLKWTFPQISCQTKA
VYDEFDREIFDFQKNNNQAQIYKKLSTKELLQNFKNKELNDLFTPCATLYPKMKSYLQED
FFLSGSGSSVFKVDR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttacgctaaagcaaatatttttttaaaacttaccggttttgactcaagaaaa
tatcatcttttagaatcacgattcatacttttaaaagatgtttttgatgagcttgagctt
gttgataaagaatcagattctaaaaaagaatttgaaatcattagtaattttaaatgcgaa
aataatattattcaaaaggcttatttgctactttctagaagatataataacgaattaaaa
gaattatttagcaaaaaaagcctaaaactcacaaaaaatatccccgtatgtgctgggctt
ggtggtggaagtagcgattgtgcgagttttttgctactaatgaatgaaaccttaaatttg
aaattaaacctgcaagaacttataaatttaagcatacaactaggaagtgatattgctttt
tttttaagtggctttaattctgctaatgtaagtggctgtggcgaaattatagaagaattt
gaagatgacatacccactttaaaatggacttttccacaaatatcttgccaaactaaagct
gtttatgatgaatttgatagagaaatatttgactttcaaaaaaacaacaatcaagcgcaa
atctacaaaaaactcagtacaaaagagttattacaaaactttaaaaacaaagaattaaat
gatttatttactccttgtgcaactttatatcctaaaatgaagtcttatttacaagaagat
ttttttctaagcggtagcggtagtagtgtttttaaggttgatcgatga

DBGET integrated database retrieval system