KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_0688Help
Entry
JJD26997_0688     CDS       T00573                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    JJD26997_0688 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    JJD26997_0688 (dapE)
Enzymes [BR:cjd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     JJD26997_0688 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
623997..625094
Genome map
AA seq 365 aa AA seqDB search
MNAKEFLIELLKFKSVTPNDDGALNFIAMELSDFEAFFIEKEGIKNLLLTKKFKDEGEHL
AFGGHVDVVPAGEGWSSDAFVPMEKESFIYARGAQDMKSGVAAFVDALKNADFKGARLSL
ILTSDEEGEAIYGTKAVLEWMQKRDMLPDYAVVAEPTCVKKIGDSIKIGRRGSINGKLLI
RGKQGHVAYPEKCINPVHDFAPVLKLLAGFDLDPGSAEFSPSKIVVTDIRGGIEVCNVTP
NDLKLMFNVRNSPDTSLEDVKSYVEKICHGLNYELELKQSSEAFLTNIDNKIVQKMNESV
QKITHEVPELNTKGGTSDARYFAKYGVKVVEFGVCNDRIHAIDERVSIEEFEKLCLVFKD
LIENF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaaagaatttttaatcgaacttttaaaatttaaatctgttacgccaaatgat
gatggagctttaaatttcatcgctatggaactgagtgattttgaagctttttttatagaa
aaagaaggcattaaaaaccttttactcactaaaaaatttaaagatgagggtgagcattta
gcttttggtgggcatgtagatgtggtgcctgcaggcgaaggttggagtagcgatgctttc
gtgcctatggaaaaagaaagctttatctatgcaaggggtgctcaagatatgaaaagcgga
gtagcagcctttgtagatgctctaaagaatgcggattttaaaggagctaggctgagtctt
attttaacaagtgatgaagaaggcgaggctatatatggaaccaaggctgttttagaatgg
atgcaaaaaagagatatgctacctgattatgccgtggttgcagagccaacctgtgttaaa
aaaatcggcgatagtattaaaatagggcgtcgtggttctatcaatggaaagcttttaatc
cgtggaaaacaagggcatgttgcttatcctgaaaaatgtatcaatcctgtgcatgatttt
gctccagtgttaaagcttttagcgggttttgatcttgatcctggaagtgctgaatttagt
ccttcaaaaatcgttgttaccgatattcgcggaggtatagaggtgtgtaatgttacgcca
aatgatttaaaacttatgtttaatgttcgcaattctcctgatacaagcttagaagatgta
aaaagctatgtagaaaaaatttgtcatggtttaaactatgagttagagctaaaacaatca
agtgaagcttttttgacaaatattgacaataaaatcgttcaaaaaatgaatgaaagcgtt
caaaaaatcactcatgaagtaccagagcttaataccaaaggtggcacaagtgatgcaagg
tattttgcaaaatacggtgtaaaggtagtggaatttggggtttgtaatgatagaattcac
gctattgatgaaagagtaagcatagaagaatttgaaaaactttgccttgtttttaaagac
ttgatagaaaatttttaa

DBGET integrated database retrieval system