KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_0704Help
Entry
JJD26997_0704     CDS       T00573                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    JJD26997_0704
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    JJD26997_0704
Enzymes [BR:cjd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     JJD26997_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(633293..633835)
Genome map
AA seq 180 aa AA seqDB search
MAMDFAIKESKILSGVYIITPNFFEDFRGEIWSVFEDKAFVNLLPKGLNFVLDKFTLSKP
NVLRGIHGDHKSWKLVTCVSGEIQQVVVDCRKESPTYLKYESFNISSKQKKLILIPPFFG
NAHYVLGDKEALYYYKWAYEGEYVDAEDQFTYAWNDERIGIKWQGENPILSERDLKVLRG
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggctatggattttgcgataaaggaaagtaagattttaagtggcgtttatatcattaca
ccgaatttttttgaggattttagaggcgaaatttggtctgtttttgaggataaagcattt
gtcaatttactgccaaagggcttaaatttcgtgctggataaattcactctttctaagcct
aatgttttaaggggcatacacggagaccataaatcgtggaaacttgtaacttgcgtgagt
ggagagattcagcaggttgtggtcgattgtcgtaaagaaagtcctacttatttaaaatat
gaaagttttaatatctcttcgaaacaaaaaaaactgattttaatcccaccattttttggt
aatgcacattatgttttgggcgataaagaagcactttattattataaatgggcttatgag
ggcgagtatgtcgatgcagaggatcaatttacttatgcgtggaacgatgagagaataggc
attaaatggcaaggggaaaatcctattttgtccgagcgtgatttaaaagtgctaaggggt
taa

DBGET integrated database retrieval system