KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_0794Help
Entry
JJD26997_0794     CDS       T00573                                 

Gene name
hemB
Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
cjd00860  Porphyrin and chlorophyll metabolism
cjd01100  Metabolic pathways
cjd01110  Biosynthesis of secondary metabolites
cjd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    JJD26997_0794 (hemB)
Enzymes [BR:cjd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     JJD26997_0794 (hemB)
Exosome [BR:cjd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   JJD26997_0794 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABS44113
UniProt: A7H344
Position
717137..718120
Genome map
AA seq 327 aa AA seqDB search
MLKRFRRLRLNDRLRAIVRENSLSVNDLIYPLFVVNGRGIKKEISSMPDVFQMSLDEILK
ECQNVINLGIKAIILFGVLENEKKDSCGSDALDDEGLVARSIREIKKNFPDLFIISDLCF
CEYTDHGHCGIIDPKTKSVDNDATLEISAKQALVHARAGVDMMAPSGMMDGIITTLREAL
DKEGFENLPIMAYSTKFASSYYGPFRDVAESAPSYGDRKSYQMDFANGKEALEESLEDEA
QGADILMVKPALAYLDVVKEISLHSNLPLCVYNVSGEYAMLKAAKNAGVIEYEKVLYETM
IAFKRAGVKLIITYHAKELAKMLKGEK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgcttaaaagatttagaagattaagacttaatgatcgtttaagagccatagtaagagaa
aattctttaagtgtgaatgatttgatttatccactttttgtggttaatggaagggggata
aaaaaagaaatttcttctatgcccgatgtatttcagatgagtttagatgaaattttaaaa
gagtgtcaaaatgtaatcaatttaggcattaaagctattatactttttggtgttcttgaa
aatgagaaaaaagacagttgtggaagtgatgctttagatgatgaagggcttgttgcaaga
agcataagagagattaagaaaaattttccagatctttttataatcagcgatctttgtttt
tgcgaatacacagatcatgggcattgtgggattatcgatccaaaaacaaaaagtgtggat
aatgatgccactttagaaatttcagccaagcaagctttagttcatgcaagagcaggggta
gatatgatggcacctagtggaatgatggacggtattatcactactttgcgtgaagcttta
gataaagaaggttttgaaaatttgcctataatggcgtattcgactaaatttgcatcaagt
tattatgggccatttcgagatgtagcagaatcagctccaagttatggagatagaaaaagc
tatcaaatggattttgctaatggtaaagaagctctagaagaaagcttagaagatgaagcg
caaggagctgatattttgatggtaaaacctgctcttgcttatcttgatgtggttaaagaa
atatctcttcattctaacttgcctttgtgtgtttataatgtaagcggagaatatgctatg
ttaaaagcagctaaaaatgcaggagtgattgagtatgaaaaagttttgtatgaaactatg
atagcttttaaaagagcaggagtaaagcttatcatcacttatcatgctaaagaattagct
aaaatgttaaaaggagaaaaatga

DBGET integrated database retrieval system