KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_0933Help
Entry
JJD26997_0933     CDS       T00573                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
830865..831629
Genome map
AA seq 254 aa AA seqDB search
MKIFSKIILSSLALASLLHAQTLIEQQEESLVKGVIPSTKIAKVERSQIDGFYKAYLDNG
NILYVNPFKRIIFIGELYTNTGASLTANDRDAWQSEVSTKQAKDLSLKEVTQYAKKVDFG
KGSKKYEFVLFTDPECPFCARVEELFIKKDVSVYVNFFPLSIHSHAEQWSKEILSAPDFK
EALIKLRETQKDLEVKITPQAEQTLKKMRELGEKLNIMGTPKLLVVDKKERKIIDVIDGA
NMQKINSYLDKDKQ
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttttctaaaataattttaagttctttagctttagcaagcttacttcatgct
caaactcttattgaacaacaagaagaatcattggtgaaaggtgttattccttcaacaaaa
atagctaaagtagaaagaagccaaattgatggattttataaggcttatttggataatgga
aatatactctatgtcaatccttttaaaaggataatatttattggagaactttatacgaat
acaggtgcaagtttaacagctaatgatagagatgcttggcagagcgaagttagcactaaa
caagctaaagatttaagtttaaaagaagttacacaatacgctaaaaaagtagattttgga
aagggttctaaaaagtatgagtttgttctttttaccgatcctgaatgtccattttgtgca
agagtagaagagctttttatcaaaaaagatgtcagtgtttatgtaaatttctttccttta
agtattcactcccatgctgaacaatggagtaaagaaattttatctgcgcctgattttaaa
gaagctctaattaaactcagagaaactcaaaaagatttagaagtaaaaattactccacaa
gcagaacaaactcttaaaaaaatgagagaattgggtgaaaagctaaatattatgggcact
ccaaaacttttagtagtggataaaaaagagagaaaaatcattgatgtaattgatggggca
aatatgcaaaaaatcaattcttatttagataaggataaacaatga

DBGET integrated database retrieval system