KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_0933Help
Entry
JJD26997_0933     CDS       T00573                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Brite
Enzymes [BR:cjd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     JJD26997_0933
Secretion system [BR:cjd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   JJD26997_0933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
830865..831629
Genome map
AA seq 254 aa AA seqDB search
MKIFSKIILSSLALASLLHAQTLIEQQEESLVKGVIPSTKIAKVERSQIDGFYKAYLDNG
NILYVNPFKRIIFIGELYTNTGASLTANDRDAWQSEVSTKQAKDLSLKEVTQYAKKVDFG
KGSKKYEFVLFTDPECPFCARVEELFIKKDVSVYVNFFPLSIHSHAEQWSKEILSAPDFK
EALIKLRETQKDLEVKITPQAEQTLKKMRELGEKLNIMGTPKLLVVDKKERKIIDVIDGA
NMQKINSYLDKDKQ
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttttctaaaataattttaagttctttagctttagcaagcttacttcatgct
caaactcttattgaacaacaagaagaatcattggtgaaaggtgttattccttcaacaaaa
atagctaaagtagaaagaagccaaattgatggattttataaggcttatttggataatgga
aatatactctatgtcaatccttttaaaaggataatatttattggagaactttatacgaat
acaggtgcaagtttaacagctaatgatagagatgcttggcagagcgaagttagcactaaa
caagctaaagatttaagtttaaaagaagttacacaatacgctaaaaaagtagattttgga
aagggttctaaaaagtatgagtttgttctttttaccgatcctgaatgtccattttgtgca
agagtagaagagctttttatcaaaaaagatgtcagtgtttatgtaaatttctttccttta
agtattcactcccatgctgaacaatggagtaaagaaattttatctgcgcctgattttaaa
gaagctctaattaaactcagagaaactcaaaaagatttagaagtaaaaattactccacaa
gcagaacaaactcttaaaaaaatgagagaattgggtgaaaagctaaatattatgggcact
ccaaaacttttagtagtggataaaaaagagagaaaaatcattgatgtaattgatggggca
aatatgcaaaaaatcaattcttatttagataaggataaacaatga

DBGET integrated database retrieval system