KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_1084Help
Entry
JJD26997_1084     CDS       T00573                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    JJD26997_1084 (folP)
Enzymes [BR:cjd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     JJD26997_1084 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(957242..958384)
Genome map
AA seq 380 aa AA seqDB search
MKFFKINPNTDFNLLCSLINPHKMGQKIMSEKTKTHYIFIKDISTPAANILKQDALRVGA
ELITHKEVITAKITHSNALLMASKEQIQKLIAKEKLQDFGLKNLALFLQKDFLKPKKAEL
MAVINVNEDSFNAKSRVSEKDFEKRLNDFLALKPEYIDIGAVSSRPGSEYCGKEEEFKRL
KKILDLIHEKNYHEKAIFSLDSFDEYCLEYALNKGFKLINDITSLRNLNLAKLASKYEAK
YCLMHMQNNPNNMQDNPFYEDLLDEMTLFFKEKLELLESFGVKESILDVGIGFGKSAEHN
MILIKHLEHFLQFNKPLLIGASRKSVINAYFQSEIKDRLAGTLYLHLKAFENGASIIRVH
DLYEHKQLFALVQAMDNIGV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttttaaaatcaatccaaacaccgattttaacttgctttgttctcttataaac
cctcataaaatggggcaaaagattatgagtgagaaaacaaaaactcattatatttttatc
aaagatatttctactcctgcagcaaatattttaaaacaagatgctttaagagtaggagct
gaacttattacccataaagaagtaattactgcaaaaatcactcattcaaatgcgctttta
atggcaagtaaagaacaaattcaaaagcttattgctaaagaaaaacttcaagattttgga
cttaaaaatttggctctttttttgcaaaaagattttttaaaaccaaaaaaagccgagctt
atggcagtgattaacgtcaatgaagacagttttaatgcaaaaagtcgtgtgagtgaaaaa
gactttgaaaaaaggcttaatgattttcttgctttaaagcctgagtatatcgatataggt
gcagtaagttcaagacctgggagtgagtattgtggtaaggaagaagaatttaaaagactc
aaaaaaatacttgacttaattcatgagaaaaattatcacgaaaaagcgatttttagttta
gatagttttgatgagtattgtctagaatatgccttaaataagggttttaaactcattaat
gatattacaagtttaagaaatcttaatctagctaaacttgcaagtaaatatgaggcaaaa
tattgcttaatgcacatgcaaaacaatccaaataacatgcaagataatcctttttatgaa
gatttacttgatgagatgactttgttttttaaagaaaaacttgaacttttagaaagtttt
ggagtaaaagaaagtattttagatgtaggtattggctttggaaagagtgcggagcataat
atgattttaatcaaacatttggagcattttttgcaatttaataaacctttgcttataggt
gcgagtcgcaaaagtgtgattaatgcatattttcaaagcgagattaaagatcgtttggca
gggactttgtatttgcatttaaaggcttttgaaaatggtgctagtattataagagtgcat
gatttatatgagcacaaacaactttttgctttagtacaggcaatggataatataggagtt
tag

DBGET integrated database retrieval system