KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_1198Help
Entry
JJD26997_1198     CDS       T00573                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    JJD26997_1198 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JJD26997_1198 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    JJD26997_1198 (thrC)
Enzymes [BR:cjd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     JJD26997_1198 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1049029..1050441)
Genome map
AA seq 470 aa AA seqDB search
MKLVESRNVNNVTSFKEALINPNASEGGLYSPLNLPVFEGEKYANLSYKDFALKLIESFG
FGEEELFKKALKSYESFDDKNTPISLQKIAEKTYINELWHGPTRAFKDMALQPFGVLLSE
FSKDKNILIICATSGDTGPATLKSFENAKNVKVACMYPKGGTSGVQELQMRALDKDNLKV
FAIDEDFDAAQRILKELLFSKDFQNEIKALNYELCAANSVNFGRILFQIIYHYYASLKLF
NEFLEEVQIIIPSGNFGNALGAFYAKKMGAKISKIKITSNANNILSEFFNQGVYDLREKS
LKKTISPAMDILVSSNIERLLFAKFKDKRTKELMNLLKNERYFKLEKEELQSLQEDFEAD
FCTDEECMQFIKQSKILIDPHTATCFKMLDLLKPSIITSTAEWTKFTPSMIKALYGRDSK
NEKEDLKFIAKEFNVQVKDEILALFDLKNSDKNVFESKNIKKEILNWMQK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtagagagtagaaatgtaaataatgtaacaagttttaaggaagctttgatt
aacccaaatgcctctgaaggagggctttattcgcctttgaatttgcctgtttttgaagga
gaaaaatatgccaatttatcctataaagattttgctttaaagcttatagaaagttttggt
tttggtgaagaagagctttttaaaaaagctttgaaaagttatgaaagctttgatgataaa
aatacacctatttctttgcaaaaaatcgctgaaaaaacctatattaacgagctttggcat
gggcctacaagagcttttaaagatatggctttacagccttttggcgtgcttttaagtgaa
ttttcaaaggataaaaatattttaattatctgtgctacaagtggcgatacaggacctgca
actttaaaaagttttgaaaatgcaaaaaatgttaaagtagcttgtatgtatccaaaaggt
ggcacaagtggagttcaagagttacaaatgcgagctttagataaggataatttgaaagtt
tttgccatagatgaggattttgacgcagcgcaacgcattttaaaagaattgcttttttct
aaagattttcaaaatgaaattaaagccttaaattacgagctttgcgcagcaaattctgtc
aattttgggcgtattttatttcagattatttatcattattatgcgagtttaaaacttttt
aatgagtttttagaagaagtgcaaatcatcattcctagtggaaattttggcaatgcttta
ggggctttttacgctaaaaaaatgggagctaaaatttcaaaaatcaaaatcacctcaaat
gcgaataatattttgagtgaattttttaatcaaggcgtttatgatttgcgtgaaaaaagt
cttaaaaagactatttctccagctatggatatacttgtttcatctaatatagaaagactt
ttgtttgcgaaatttaaagataaaagaactaaagaactgatgaatttgttgaaaaatgag
agatattttaaacttgaaaaagaagaattacaaagtttgcaagaagattttgaggcggat
ttttgcactgatgaagaatgtatgcaatttatcaaacaaagtaagattttaatcgatccg
cacacagcaacttgttttaaaatgcttgatcttttaaaacctagcattatcacttcgaca
gcagaatggacaaaatttactccaagtatgataaaagctttatatggtagagattctaag
aatgaaaaagaagatttaaaatttatagctaaagagtttaatgtccaagttaaagatgaa
attttagctttatttgatttgaaaaatagcgataaaaatgtatttgaatctaaaaatata
aaaaaagaaattttaaattggatgcaaaaatga

DBGET integrated database retrieval system