KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_1211Help
Entry
JJD26997_1211     CDS       T00573                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    JJD26997_1211 (ruvA)
Enzymes [BR:cjd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     JJD26997_1211 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1063655..1064206
Genome map
AA seq 183 aa AA seqDB search
MVVGIEGIITKKEPTFIIVKCASGLSYGIFISLFCSAKIQTQEKHEFFITQIIKEDSNKF
YGFLDKDEQKMFEMLLKVNGVGANTAMAVCSSLDINSFYKALSLGDESVLKKVPGIGPKS
AKRIIVELSDTRTKLENVSDDKSEALAALLTLGFKQEKIISVLASAQATGTSELIKEALK
KLR
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcggcatcgaaggaataatcacaaaaaaagaacctacttttatcattgttaaa
tgtgctagtggtttaagctatgggatatttatttcgcttttttgttctgctaaaattcaa
acccaagaaaagcatgagttttttatcactcaaattatcaaagaagattctaataaattt
tatggtttcttagataaagatgaacaaaaaatgtttgaaatgcttttgaaagtcaatgga
gtaggtgcaaatactgctatggcagtatgctctagtcttgatataaattctttttacaaa
gcgttaagtttgggcgatgaaagcgtgcttaaaaaagtacctggtataggtccaaaaagt
gcaaaacgtattatagtagaactttcagatacaagaaccaaacttgaaaatgtaagcgat
gataaaagtgaagccttagccgcacttcttactctaggctttaaacaagaaaaaatcata
agtgttttagcaagtgctcaggcaacaggcacaagcgaactcatcaaagaagctcttaaa
aaactaagataa

DBGET integrated database retrieval system