KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_1397Help
Entry
JJD26997_1397     CDS       T00573                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
cjd00020  Citrate cycle (TCA cycle)
cjd00640  Propanoate metabolism
cjd00660  C5-Branched dibasic acid metabolism
cjd01100  Metabolic pathways
cjd01110  Biosynthesis of secondary metabolites
cjd01120  Microbial metabolism in diverse environments
cjd01130  Biosynthesis of antibiotics
cjd01200  Carbon metabolism
Module
cjd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    JJD26997_1397 (sucC)
   00640 Propanoate metabolism
    JJD26997_1397 (sucC)
   00660 C5-Branched dibasic acid metabolism
    JJD26997_1397 (sucC)
Enzymes [BR:cjd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     JJD26997_1397 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: ABS44414
UniProt: A7H4K9
Position
complement(1237600..1238763)
Genome map
AA seq 387 aa AA seqDB search
MNIHEYQAKAIFADNGILTLKGKVAFSVDEAVSNAKELGGSVWAVKAQIHAGGRGLGGGV
KIAKNLDEVKDYASKILGMNLVTHQTGPEGKLVQKLYIESGANIVKEYYLAILFNRMAEQ
ITIIASSEGGMDIEKVAKESPGKIAKVGIDPQIGFKMFHGLEVARVLGLDKDEGKKLISM
IAKLYKLYMDKDMNMLEINPLIKTAEGDFYALDAKCSFDDSALYRHPEIAELRDITEENP
AEREAAEFGLSYVKLDGDVACMVNGAGLAMATMDIINYSGAKPANFLDVGGGASPETVAK
AFEIILRDKNVKVIFINIFGGIVRCDRIANGILEATKNVEVNIPIVVRLDGTNAAEAKTI
LDNSNLKNIKAATNLKNGAELVKSLVG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacatgagtatcaagcaaaagcaatttttgcggacaatggcatccttacttta
aagggaaaagtcgcatttagcgtagatgaagctgtgtctaatgctaaagaattaggtggt
agtgtttgggcggttaaagctcaaattcacgcaggaggtcgtggtcttggtggtggtgtt
aaaatcgctaagaatttagatgaggtaaaagattacgcgagtaaaattttaggaatgaat
ttagtaactcatcaaacaggacctgaaggcaagctcgtgcaaaaactttatatagaaagt
ggcgctaatatagtaaaagagtattatttggctattttatttaatagaatggcagagcaa
attaccattatcgcttcaagtgaaggagggatggatatagaaaaagtagccaaagaaagt
cctgggaaaattgcaaaagtaggcattgatccacaaatcggttttaaaatgtttcatgga
cttgaagtagcgagagttttaggacttgataaagatgaaggtaaaaaactcatttccatg
atagctaaactttataagctttatatggataaagatatgaatatgcttgaaatcaatcct
ttgattaaaactgcagaaggggatttttatgcccttgatgcaaaatgcagttttgatgat
agtgcgctttatcgtcatcctgaaattgctgaacttagagatattaccgaagaaaatcct
gctgaaagagaagcggctgaatttggcttaagctatgtgaaattagatggagatgtagct
tgtatggtaaatggcgcgggtctagcaatggcaactatggatattattaattatagtggt
gcaaaacctgcaaacttcttagatgtaggtggaggagcttcacctgaaactgttgcaaag
gcttttgaaatcattttaagagataaaaatgtaaaagttatatttatcaatatctttggt
ggtattgttcgttgtgataggatagcaaacggaattttagaagctactaagaatgttgag
gtaaatattccaattgtagtgcgtcttgatggcactaacgcagcggaagcaaagacgatt
ttagataattcaaatcttaaaaatatcaaagcagcaaccaatcttaaaaacggtgcagag
cttgtaaaaagtttagtaggataa

DBGET integrated database retrieval system