KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_1610Help
Entry
JJD26997_1610     CDS       T00573                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    JJD26997_1610 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JJD26997_1610 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    JJD26997_1610 (trpA)
Enzymes [BR:cjd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     JJD26997_1610 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1421407..1422156)
Genome map
AA seq 249 aa AA seqDB search
MVDFRKFYKENANVAYTVLGYPNLQISEAFLQRLDQSPIDILELGVAYSDPIADGEIIAD
AAKIALDQGVDIHSVFELLARIKTKKALVFMVYYNLIFSYGLEKFVKKAKSLGICALIVP
ELSFEESDDLVKECEKYNIALITLVSVTTPKERVKKLVKHAKGFIYLLASIGITGTKSVE
EAILQDKVKEIRSFTNLPIFVGFGIQNNQDVKRMRKVADGVIVGTSIVKYFKQENLDIIM
KDIEEIFKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggttgattttagaaaattttataaagaaaatgcaaatgttgcttatacggttttaggt
tatccaaatcttcaaataagtgaagcttttttgcaaagattagatcaaagccctattgat
attttagaacttggcgttgcttatagtgatcctattgcagatggtgagattattgcagat
gcggcaaaaatagctcttgatcaaggtgtagatattcatagtgtttttgagcttttagct
aggataaaaactaaaaaagctttggtttttatggtttattataatctaattttttcttat
ggtttggaaaaatttgtgaaaaaagcaaaatctttagggatttgtgctttgattgtacct
gaattaagctttgaagaaagtgatgatttggttaaagagtgtgaaaaatataatatagct
ttaattacacttgtaagtgttacaacccctaaagaaagggttaaaaagttagtaaaacat
gctaagggctttatttatttattagcaagtataggtattacaggtacaaaaagtgtcgaa
gaagcaatcttgcaagataaagtaaaagaaatcagatcttttacaaatttgcctattttt
gtaggttttggtattcaaaataatcaagatgtaaaaagaatgagaaaagttgctgatgga
gtaattgtaggaactagcatagtaaagtattttaaacaagaaaatttggatataataatg
aaagatattgaagaaattttcaaaaaataa

DBGET integrated database retrieval system