KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_1611Help
Entry
JJD26997_1611     CDS       T00573                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
cjd00260  Glycine, serine and threonine metabolism
cjd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cjd01100  Metabolic pathways
cjd01110  Biosynthesis of secondary metabolites
cjd01130  Biosynthesis of antibiotics
cjd01230  Biosynthesis of amino acids
Module
cjd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JJD26997_1611 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    JJD26997_1611 (trpB)
Enzymes [BR:cjd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     JJD26997_1611 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF3708
Motif
Other DBs
NCBI-ProteinID: ABS44275
UniProt: A7H523
Position
complement(1422149..1423327)
Genome map
AA seq 392 aa AA seqDB search
MKKAYYGDFGGQFLPESAMFALNELENAFLKFSKDKFFKKELSELLKTYVGRPTPLYFAR
NLSKKYQHEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAETGAGQHGLATATAA
ALLGLECEIYMGATDVQRQALNVYKMELLGAKIHAVQSGLKTLKEATTAAIQAWVGDIKN
IFYVVGSAVGPYPYPKMVTHFQSIIGKECKMQLQKLNKKVDYIIAAVGGGSNAAGIFYDF
IKDENVKLIGIEAGGLGVDTLYHAATLNKGETGIIHGMKTKVLQDDLGNILPVHSVSAGL
DYPGIGPLHAFLFESKRAQYHAISDEECMQALKLLCKEEGIIAAIESSHALAFLEKLCPT
LKKKSVIVINLSGRGDKDMQMIREYKKGVIYG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcgtattatggggattttggtgggcagtttttgcctgaaagtgcaatgttt
gctttaaatgagctagaaaatgcttttttgaaattttctaaagataaattctttaaaaaa
gaattaagtgagcttttaaaaacttatgtgggacgtcctactccgctttattttgctaga
aatttaagtaaaaaatatcaacatgaaatttatttaaaacgcgaggatttaaatcatacc
ggagcacataaaattaataatgctatcgctcaagcccttttagcaaaaaaaatgggaaag
aaaaaaatcatagcagaaacaggagcaggtcaacacggacttgcaacagccactgcagca
gcgcttttaggacttgaatgtgaaatttatatgggagcaactgatgtgcaaagacaggct
ttaaatgtttataaaatggagcttttgggtgctaaaattcatgcagtacaaagtggactt
aaaactctaaaagaagccactactgcagctattcaagcttgggttggggatattaaaaat
attttttatgtggttggaagtgcggtaggtccttatccttatcctaaaatggtaacgcat
tttcaaagcattataggaaaagaatgcaaaatgcaacttcaaaaactcaataaaaaagta
gattatattatcgcagctgttgggggtggaagcaatgcagcaggaatattttatgatttt
atcaaagatgaaaatgttaaacttataggtattgaagcaggggggcttggcgttgataca
ctttatcatgcagcgactttaaataagggggaaacaggcattattcacggtatgaaaacc
aaagttttacaagatgatttaggcaatatcttgcctgtgcatagtgtttctgcagggctt
gattatccaggaattggccctttgcatgcttttttatttgaaagtaaaagagcgcaatat
catgctataagcgatgaagaatgtatgcaagctttaaaattactttgtaaagaagaaggt
attattgcagcgattgaaagttcgcatgctttagcgtttttagaaaaactttgtccaact
ttaaaaaagaaaagcgtgatagtaataaacctttcaggtaggggagataaagatatgcaa
atgattagagaatataaaaagggagtgatttatggttga

DBGET integrated database retrieval system