KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_1735Help
Entry
JJD26997_1735     CDS       T00573                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
cjd00010  Glycolysis / Gluconeogenesis
cjd00051  Fructose and mannose metabolism
cjd00562  Inositol phosphate metabolism
cjd01100  Metabolic pathways
cjd01110  Biosynthesis of secondary metabolites
cjd01120  Microbial metabolism in diverse environments
cjd01130  Biosynthesis of antibiotics
cjd01200  Carbon metabolism
cjd01230  Biosynthesis of amino acids
Module
cjd_M00002  Glycolysis, core module involving three-carbon compounds
cjd_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JJD26997_1735 (tpiA)
   00051 Fructose and mannose metabolism
    JJD26997_1735 (tpiA)
   00562 Inositol phosphate metabolism
    JJD26997_1735 (tpiA)
Enzymes [BR:cjd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     JJD26997_1735 (tpiA)
Exosome [BR:cjd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   JJD26997_1735 (tpiA)
  Exosomal proteins of bladder cancer cells
   JJD26997_1735 (tpiA)
  Exosomal proteins of melanoma cells
   JJD26997_1735 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM BtpA
Motif
Other DBs
NCBI-ProteinID: ABS44309
UniProt: A7H5C4
Position
complement(1526846..1527517)
Genome map
AA seq 223 aa AA seqDB search
MIFAANLKCNHTRASFKIYAEILNKTMGAKCDDIIVFPPSVAFLENENNFMQGAQNFYPC
VNGAFTGELGKEHLDEFGIKCVLIGHSERRALGDEELIKVKFNFAKEHGYKIIFCIGENL
DTKNSGKTLEFLKKQLEIIDLNYEKLIIAYEPIYSIGTGVSAQTADIAKVLEFLASLTKV
PLLYGGSVNENNIKEILSVNHCGGVLIGSAALKVENFIKLIKG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatctttgctgcaaatttaaaatgcaatcacacaagggcaagctttaaaatttatgct
gaaattttaaataaaactatgggggcaaaatgcgatgatatcatcgttttcccacctagt
gtagcatttttagaaaatgaaaataacttcatgcaaggagcgcaaaatttttatccttgt
gttaatggagcttttacaggcgagcttggaaaagaacatttggacgaatttgggatcaaa
tgtgttttaatcgggcattctgaaagaagagctttaggagatgaagaacttattaaggtt
aaatttaattttgctaaagagcatggttataaaattattttttgtataggtgaaaattta
gatacaaaaaattcaggcaagactttagagtttttaaaaaaacaacttgaaattattgat
ttaaattatgaaaaactcatcatcgcttatgagcctatttattctataggaacgggagtg
agtgcacaaactgcagatattgctaaagtgcttgaatttttagcgagtttaactaaggtg
cctttactttatggtggaagtgtgaatgaaaataatatcaaagaaattttaagtgtaaat
cattgtggtggagttttgataggctctgcagctttaaaagtagaaaattttataaaatta
atcaaaggataa

DBGET integrated database retrieval system