KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_1735Help
Entry
JJD26997_1735     CDS       T00573                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:cjd01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cjd01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cjd00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cjd00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cjd00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1526846..1527517)
Genome map
AA seq 223 aa AA seqDB search
MIFAANLKCNHTRASFKIYAEILNKTMGAKCDDIIVFPPSVAFLENENNFMQGAQNFYPC
VNGAFTGELGKEHLDEFGIKCVLIGHSERRALGDEELIKVKFNFAKEHGYKIIFCIGENL
DTKNSGKTLEFLKKQLEIIDLNYEKLIIAYEPIYSIGTGVSAQTADIAKVLEFLASLTKV
PLLYGGSVNENNIKEILSVNHCGGVLIGSAALKVENFIKLIKG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatctttgctgcaaatttaaaatgcaatcacacaagggcaagctttaaaatttatgct
gaaattttaaataaaactatgggggcaaaatgcgatgatatcatcgttttcccacctagt
gtagcatttttagaaaatgaaaataacttcatgcaaggagcgcaaaatttttatccttgt
gttaatggagcttttacaggcgagcttggaaaagaacatttggacgaatttgggatcaaa
tgtgttttaatcgggcattctgaaagaagagctttaggagatgaagaacttattaaggtt
aaatttaattttgctaaagagcatggttataaaattattttttgtataggtgaaaattta
gatacaaaaaattcaggcaagactttagagtttttaaaaaaacaacttgaaattattgat
ttaaattatgaaaaactcatcatcgcttatgagcctatttattctataggaacgggagtg
agtgcacaaactgcagatattgctaaagtgcttgaatttttagcgagtttaactaaggtg
cctttactttatggtggaagtgtgaatgaaaataatatcaaagaaattttaagtgtaaat
cattgtggtggagttttgataggctctgcagctttaaaagtagaaaattttataaaatta
atcaaaggataa

DBGET integrated database retrieval system