KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_1740Help
Entry
JJD26997_1740     CDS       T00573                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.2 5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JJD26997_1740 (algC)
   00030 Pentose phosphate pathway
    JJD26997_1740 (algC)
   00051 Fructose and mannose metabolism
    JJD26997_1740 (algC)
   00052 Galactose metabolism
    JJD26997_1740 (algC)
   00500 Starch and sucrose metabolism
    JJD26997_1740 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    JJD26997_1740 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    JJD26997_1740 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    JJD26997_1740 (algC)
Enzymes [BR:cjd01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     JJD26997_1740 (algC)
    5.4.2.8  phosphomannomutase
     JJD26997_1740 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1531030..1532400)
Genome map
AA seq 456 aa AA seqDB search
MLDVIFREYDIRGLYGKELNEKSVKAIGFCLGQTMLNKGCKNVSVGYDARYSANELFNYL
VSGLNKAGIEIYDIGLVPTPLGYFSLYEGLKFDANVMITGSHNPKDYNGFKITINKESFF
GVELKEFSKEVYKHLDDEIEENLEAQQYDILSLYVKFMCEQFSFLKDFNYKFGVDCTNGA
AGVVIEPLIKVLNLKAHVMFAEPNGQFPNHTPDPTEKENLSAIRGFLNQNQDYSLAFAFD
GDADRMVALSKTHVFCGDELCYLFAKNIPNPRILGEVKCSKNLFDEVAKFGTIFMGKTGH
SNIKKMMKEKDIDLAAEVSGHIFFKHRYFGYDDGIYAFLRALELVYKGFDLESMIKTLPK
LYTTPEIKIPVNEEEKFKLVEEFQKEIEKGALKGVKSLCEIDGARIDFGDGWALLRASNT
SPYLITRFEATSLERVKELESMVFTLFDNIKSRLKN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgtgatttttagagaatacgatatacgaggactttatggtaaagaactgaat
gaaaaaagcgttaaagctataggtttttgtttaggacaaaccatgctaaataaaggctgt
aaaaatgtaagcgtgggttatgatgcaagatatagtgcaaatgagctttttaattatcta
gttagtggacttaacaaggcagggatagaaatttatgatatagggcttgtgccaactcca
ttggggtattttagtctttacgagggcttgaaatttgatgcaaatgttatgataacagga
tctcataatccaaaagattataatggttttaaaatcactataaacaaagaaagttttttt
ggtgtagaattaaaagagttttcaaaagaagtttataagcatttagatgatgagattgaa
gaaaatttagaagcgcaacaatacgatattttaagcctttatgtcaaatttatgtgcgag
caatttagttttttaaaagattttaattataaatttggtgttgattgtacaaatggtgca
gctggagtagtgatagagcctttaatcaaagttttaaatttaaaagctcatgtaatgttt
gcagagcctaatggacagtttccaaatcatactccagatcccacagaaaaagaaaattta
agtgcgattagaggatttttaaatcaaaatcaagattattctttggcttttgcttttgac
ggggatgctgatagaatggttgctttgagtaaaactcatgtattttgtggggatgagctt
tgctatttgtttgctaaaaatatccctaatccacgcattttaggtgaggtaaaatgttct
aaaaatctttttgatgaagtggctaaatttggaactatttttatgggaaaaacaggacat
tctaatatcaaaaaaatgatgaaagaaaaagatattgatttagcagctgaagtgagtgga
catattttctttaagcatagatattttggttatgatgatggaatttatgcgtttttaaga
gctttagaacttgtttataaaggctttgatttagaaagtatgattaagactttgccaaaa
ctttatactacacctgaaattaaaattcctgtgaatgaagaagaaaaattcaaacttgtg
gaagaatttcaaaaagagattgaaaaaggagctttaaaaggggtaaaaagtctttgtgaa
attgatggagctaggatagattttggcgatggatgggctttgcttcgcgcatctaatacc
agcccttatcttatcacgcgctttgaagcaacttctttagaaagggtaaaagagcttgaa
agtatggtgtttactttatttgataatataaaatctaggcttaagaattga

DBGET integrated database retrieval system