KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_1888Help
Entry
JJD26997_1888     CDS       T00573                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
cjd00040  Pentose and glucuronate interconversions
cjd00052  Galactose metabolism
cjd00500  Starch and sucrose metabolism
cjd00520  Amino sugar and nucleotide sugar metabolism
cjd01100  Metabolic pathways
cjd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    JJD26997_1888 (galU)
   00052 Galactose metabolism
    JJD26997_1888 (galU)
   00500 Starch and sucrose metabolism
    JJD26997_1888 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    JJD26997_1888 (galU)
Enzymes [BR:cjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     JJD26997_1888 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABS43992
UniProt: A7H5P9
Position
complement(1666647..1667465)
Genome map
AA seq 272 aa AA seqDB search
MLQTCIFPAAGYGTRFLPATKTLPKEMLPILTKPLIHYGVDEALEAGMENMGFVTGRGKR
ALEDYFDISYELEHQILGTKKEYLLDEIRSLINRCTFTFTRQNQMKGLGDAVLKGRSLVG
DEAFGVILADDLCVNEEGLNVMAQMVKIYEKYRCTIIAVMEVPKEQVSNYGVISGNFVED
NLIMVNSMIEKPSPDEAPSNLAIIGRYILTPDIFGILENTQAGKNGEIQLTDALLTQATN
GMVLAYKFQGKRFDCGSVEGFVEATNYFLRKK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaacttgtatttttcctgcagcaggttatgggacgagatttttacctgcaaca
aaaactttacctaaagagatgttacctatcttaactaagcctttgatccattatggagtt
gatgaagctttggaagcgggaatggaaaatatgggctttgtaacagggcgtggaaaaaga
gctttggaggattattttgatatttcttatgaacttgagcatcaaattttaggcacaaaa
aaagaatacttacttgatgaaattcgctctttgatcaatcgttgcacctttacttttaca
agacaaaatcaaatgaaaggcttaggtgatgcggttctaaaaggtagatctttagttggc
gatgaagcttttggtgtgattttggctgatgatttgtgtgtcaatgaagaaggcttaaat
gttatggctcaaatggtaaaaatttatgaaaaatatcgctgcaccatcatagctgtgatg
gaagtaccaaaagagcaagtttcaaactatggagtaatttctggaaattttgtagaagat
aatcttatcatggttaattctatgatagaaaaaccaagtcctgatgaagctccaagtaat
cttgctatcataggaagatatattttaactcctgatatttttggaattttagaaaatact
caagcaggaaaaaatggcgaaattcaacttacagacgcacttttaactcaagcaaccaat
ggtatggttttagcttataaatttcaagggaaacgctttgattgtgggagtgtagaaggc
tttgtagaagcgacaaattattttttacgaaaaaagtaa

DBGET integrated database retrieval system