KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_1888Help
Entry
JJD26997_1888     CDS       T00573                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    JJD26997_1888 (galU)
   00052 Galactose metabolism
    JJD26997_1888 (galU)
   00500 Starch and sucrose metabolism
    JJD26997_1888 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    JJD26997_1888 (galU)
Enzymes [BR:cjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     JJD26997_1888 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1666647..1667465)
Genome map
AA seq 272 aa AA seqDB search
MLQTCIFPAAGYGTRFLPATKTLPKEMLPILTKPLIHYGVDEALEAGMENMGFVTGRGKR
ALEDYFDISYELEHQILGTKKEYLLDEIRSLINRCTFTFTRQNQMKGLGDAVLKGRSLVG
DEAFGVILADDLCVNEEGLNVMAQMVKIYEKYRCTIIAVMEVPKEQVSNYGVISGNFVED
NLIMVNSMIEKPSPDEAPSNLAIIGRYILTPDIFGILENTQAGKNGEIQLTDALLTQATN
GMVLAYKFQGKRFDCGSVEGFVEATNYFLRKK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaacttgtatttttcctgcagcaggttatgggacgagatttttacctgcaaca
aaaactttacctaaagagatgttacctatcttaactaagcctttgatccattatggagtt
gatgaagctttggaagcgggaatggaaaatatgggctttgtaacagggcgtggaaaaaga
gctttggaggattattttgatatttcttatgaacttgagcatcaaattttaggcacaaaa
aaagaatacttacttgatgaaattcgctctttgatcaatcgttgcacctttacttttaca
agacaaaatcaaatgaaaggcttaggtgatgcggttctaaaaggtagatctttagttggc
gatgaagcttttggtgtgattttggctgatgatttgtgtgtcaatgaagaaggcttaaat
gttatggctcaaatggtaaaaatttatgaaaaatatcgctgcaccatcatagctgtgatg
gaagtaccaaaagagcaagtttcaaactatggagtaatttctggaaattttgtagaagat
aatcttatcatggttaattctatgatagaaaaaccaagtcctgatgaagctccaagtaat
cttgctatcataggaagatatattttaactcctgatatttttggaattttagaaaatact
caagcaggaaaaaatggcgaaattcaacttacagacgcacttttaactcaagcaaccaat
ggtatggttttagcttataaatttcaagggaaacgctttgattgtgggagtgtagaaggc
tttgtagaagcgacaaattattttttacgaaaaaagtaa

DBGET integrated database retrieval system