KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_1889Help
Entry
JJD26997_1889     CDS       T00573                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
cjd00010  Glycolysis / Gluconeogenesis
cjd00620  Pyruvate metabolism
cjd00640  Propanoate metabolism
cjd00680  Methane metabolism
cjd01100  Metabolic pathways
cjd01110  Biosynthesis of secondary metabolites
cjd01120  Microbial metabolism in diverse environments
cjd01130  Biosynthesis of antibiotics
cjd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    JJD26997_1889 (acs)
   00620 Pyruvate metabolism
    JJD26997_1889 (acs)
   00640 Propanoate metabolism
    JJD26997_1889 (acs)
  Energy metabolism
   00680 Methane metabolism
    JJD26997_1889 (acs)
Enzymes [BR:cjd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     JJD26997_1889 (acs)
Lipid biosynthesis proteins [BR:cjd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   JJD26997_1889 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABS43300
UniProt: A7H5Q0
Position
complement(1667546..1669519)
Genome map
AA seq 657 aa AA seqDB search
MLNQNNQELFKPSKEFSHNARIKNLCEYYDLCDEAKEDFEGFWKRQALEKIEWFSPFLRV
LNEDKAPFYKWFEGGTLNVSYQCLDRHMKTRRNKAALIFEGEMGDYEVYTYRRLLHETCK
TANLLKKFGVKKGDRVVIYMPMIPETAIMMLACARIGAIHSVVFGGFSPEALRDRIVDAG
AKLVVTADGAFRRGKSYMLKPAVDKALSEGCESVEKVLIVIRNNEPIEYVKGRDYVYNEL
VKNESYKCEPEIMDSEDLLFLLYTSGSTGKPKGVMHASAGYILWAQMTMEWVFDIKDYDN
YWCSADVGWITGHTYVVYGPLACGATTIMHEGTPTYPNSGRWWRMIEEYQVSKFYTSPTA
IRMLHADAPDEPRKYDLSTLEVLGTVGEPINPSAWKWFYDEIGRTKSPIVDTWWQTETGG
HMITPLPGATPLKPGCATLPLPGIFAEVIDEEGNKKDEGEDGLLCITKPWPSMIRGIWGN
DERYIESYFSQAKKGGKAVYFSGDGAFYDKNGYITITGRTDDVVNVAGHRIGTAEIEGAI
AKHPSVAESAVVSILDAIKGESLFAFVVLSPASSCDLGGAIETLKELNDILRVEIGSMAK
IEKILYTPGLPKTRSGKIMRRILRTIAKGEEIKQDISTLEDSGVVETIVKLAKAEFE
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatcaaaataatcaagagctttttaagccaagtaaagaattttctcataatgct
cgtataaaaaatttatgtgaatactatgatttatgtgatgaggccaaggaagattttgaa
ggtttttggaaaagacaagcacttgagaagatcgagtggttttcgccttttttaagagtg
ctaaatgaggataaagctccattttataaatggtttgaaggtggaactttaaatgtaagc
tatcaatgtcttgatcgtcatatgaaaacaagacgcaataaagctgctttgatttttgaa
ggtgaaatgggggattatgaagtttatacttatagaagattattgcatgaaacttgtaaa
acagctaatttgcttaaaaaattcggagtaaaaaaaggcgatagggttgtaatttatatg
cctatgattccagaaacagctataatgatgttagcttgtgcaaggattggggctattcat
agtgtggtatttggagggttttctccagaagctttgcgagataggattgtagatgcagga
gctaaacttgtagtaacggctgatggtgcttttcgtcgtggcaaatcttatatgttaaaa
cctgcagtagataaggctttaagtgaagggtgtgaaagtgtagaaaaagtacttatagtt
atacgcaataatgagcctatagaatatgttaaaggaagggactatgtttataatgaactt
gtgaaaaatgagtcttataagtgtgaacccgaaatcatggatagcgaggatttattgttt
ttgctttacacttcaggatcaacaggcaagccaaaaggagttatgcatgcaagtgcagga
tatatactttgggcacaaatgactatggaatgggtttttgatattaaagattatgataat
tattggtgtagtgctgatgtgggttggattacaggacatacttatgtagtttatgggcct
ttagcatgtggagcaacgactatcatgcatgaaggaactcccacttatccaaattccggg
cgttggtggagaatgatagaagagtatcaagtaagcaaattctacacttcgccaactgcc
ataagaatgcttcatgctgatgcacctgatgagccaagaaaatatgatttaagtacgctt
gaagtgcttggaacggttggagagcctatcaatcctagtgcttggaagtggttttatgat
gaaatagggagaactaaaagtcctatagtcgatacttggtggcaaacagaaacaggcggg
catatgatcacgcctttaccaggcgctacccctttaaaaccaggttgtgccaccttgcct
ttgccagggatttttgcagaagttattgatgaagaaggcaataaaaaagatgaaggtgaa
gatggattgctttgtataactaaaccttggccttcgatgattcgtggaatttggggtaat
gatgaacgctatatagaaagttatttttctcaagctaaaaaaggtgggaaagctgtatat
tttagtggcgatggtgctttttatgataaaaatggttacattactatcacaggaagaaca
gatgatgtggttaatgttgcaggacatcgtataggaacagctgaaattgaaggtgctatt
gctaaacatccaagtgtagcagaatcagctgtggtaagtattttggatgcgattaagggc
gagtcattgtttgcttttgtggttttaagtcctgcatctagttgtgatcttggtggagct
atagaaactttaaaagaacttaatgacattttaagagtagaaataggatctatggctaaa
atagaaaaaattctttatactccaggtttgccaaaaactagaagtggtaaaataatgaga
agaattttaagaactatagcaaaaggtgaagaaatcaaacaagatatttcaacactcgaa
gattctggagtagtagaaaccattgttaaattagctaaggcagagtttgaataa

DBGET integrated database retrieval system