KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_2001Help
Entry
JJD26997_2001     CDS       T00573                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cjd00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cjd00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1763555..1764838
Genome map
AA seq 427 aa AA seqDB search
MKLKLENSFITDNTLECEKECFFLQTTQNTKFHAQALERGAKIIDVNECKKLLKIDEKIQ
IIGITGTNGKTTTAAAIYSILLDLGYKCGLCGTRGAFINDEQIDEKSLTTSPILKTLEYL
QIATQKKCDFFIMEVSSHALIQNRIEGLKFAAKIFTNITQDHLDFHGTFENYKEAKELFF
TDESLKFINKDALAIKFNVRNAFTYGIENPALYQIKAYSLEEGISAVATNKNQTFHIDSP
LLGLFNLYNLLVASACVNELVKPDLKDLEKAISEFGGVCGRVEQVAKGVIVDFAHTPDGI
EKVLDTLKNKKLIVVFGAGGDRDKTKRPLMGKIVEHFAKIAIITSDNPRSEEPKTIMEEI
LSGFAKKEKVLMIEDRKEAIKKALELKENDDLVVILGKGDETTQEIKGVKYPFNDKVVVN
EILKNQG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaaaacttgaaaattcattcattacagacaataccttagagtgtgaaaaagaa
tgcttttttttacaaaccacacaaaatactaaatttcacgctcaagccttagaaagaggt
gcaaaaatcattgatgtaaatgagtgtaaaaaacttttaaaaatcgatgaaaagattcaa
atcataggaatcacaggaaccaatggtaaaactacaactgcagcagcgatttactctatc
ttgcttgatttaggctataagtgcggactttgtgggacaagaggggcttttatcaacgat
gaacaaatcgatgaaaaatccttaaccacctcccctattcttaaaaccttagaataccta
caaatagccactcaaaaaaaatgtgattttttcatcatggaagtaagctcacacgccttg
attcaaaaccgcatcgaaggcttaaaatttgctgctaaaatttttaccaatatcactcaa
gatcatttagattttcacggtacttttgaaaattataaagaagcaaaagaactttttttt
accgatgagagtttaaaatttatcaacaaagatgctttggctattaaatttaatgtgcgt
aacgcttttacttatggcatagaaaatcctgccttatatcaaatcaaagcttattctttg
gaagaaggtattagtgctgttgcaacaaataaaaatcaaacttttcacatagactcgccc
ttactaggacttttcaatctttacaatcttctagttgctagtgcttgtgtaaatgaactc
gtaaagcctgatttaaaagatttggaaaaagctatcagtgaatttggcggggtttgcggc
agggtagaacaagtagcaaaaggcgtgattgtggattttgctcatacgcctgatggcatt
gaaaaagtgcttgacactcttaaaaataaaaaactcatcgttgtttttggagcaggtgga
gatagagataaaaccaaacgccctttaatgggaaaaattgttgaacattttgcaaaaatt
gctatcattacaagcgacaatccacgcagcgaagaaccaaaaaccatcatggaagaaatt
ttatcaggctttgctaaaaaagaaaaagttttaatgatagaagatagaaaagaagccata
aaaaaagctttagaactaaaagaaaatgacgatttagtcgttattttaggcaaaggtgat
gaaactactcaagaaattaaaggagtaaaatatccttttaatgataaagtagttgttaat
gaaattttaaaaaatcaaggataa

DBGET integrated database retrieval system