KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_2054Help
Entry
JJD26997_2054     CDS       T00573                                 

Gene name
cysQ
Definition
cysQ protein (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    JJD26997_2054 (cysQ)
Enzymes [BR:cjd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     JJD26997_2054 (cysQ)
Transfer RNA biogenesis [BR:cjd03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    JJD26997_2054 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1803812..1804576)
Genome map
AA seq 254 aa AA seqDB search
MLNLDKFLQIAINASNQASKAILEERKNFKTWEKEDKSPLTSADLASNKILNDILGSTDI
KILSEEKLLSKEECEELKTFWLIDPLDGTSGFLKGSDEFCVMISLVHDNRPVLSLIQNPS
KDDIFYAHAKTKVYKNDKLLQINQQEYEKNKYKALLSVNHLSKDDEDFAKEHQLEAINIG
SGLKFCAILEAKAGVYKRFEKLNIWDIVAGDFLINQNGGFMGDFSKKYILYHPLNYRSSP
FICVSSRNFLQDFL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatcttgataaatttttacaaattgctataaatgctagcaatcaagcttctaaa
gctattttagaagagagaaaaaatttcaaaacttgggaaaaagaagataaaagtccgctt
acatcagcagatcttgcttctaataaaattctaaatgatattttaggttctacggatatt
aaaattttatcagaagaaaaattactcagcaaagaagagtgcgaagaattaaaaactttt
tggcttattgatcctcttgatggaacaagcgggtttttaaaaggtagtgatgaattttgc
gttatgataagtttggttcatgacaatcgccctgttttatcactcatacaaaatccatca
aaagatgatatattctatgctcatgcaaaaaccaaggtttataaaaacgataaactttta
caaatcaaccagcaagaatacgagaaaaataaatataaagccttattgagtgtcaatcat
cttagcaaagacgatgaagattttgcaaaagagcatcaattagaagctattaatatagga
tctggattgaaattttgtgctattttagaggctaaagcaggagtttataaaagatttgaa
aagcttaatatttgggatattgtagcaggggattttttaatcaatcaaaatggaggattt
atgggagatttttctaaaaaatatattttatatcatcctttaaattatagatccagtcct
tttatttgtgtttcatctaggaattttttacaagattttttataa

DBGET integrated database retrieval system