KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj0065cHelp
Entry
Cj0065c           CDS       T00026                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cje00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(78781..79254)
Genome map
AA seq 157 aa AA seqDB search
MLKIQGVKHFEKSRFFPFFSQNIRSFKYLALIGLGSNIEPEKKRFDMLFRVMMDDKRFKI
LSTSPMLINEAFGFKEQKDFTNAVMLIQTNLHARALLKVLLYYEVKFKRKRTFKNAPRTL
DLDLLYFSQKVKRDKWCEVPHKGAKERVSVILPLGMI
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaattcaaggagtaaaacactttgaaaaaagtcgtttttttcctttttttagt
caaaatatacgatcttttaaatatttagctcttataggcttaggaagcaatatagaaccc
gaaaaaaaaagatttgatatgctttttcgagtaatgatggatgataaaagatttaaaatt
ttatccacatctcctatgttgataaatgaagcctttggttttaaagagcaaaaagatttt
accaatgctgttatgttgatacaaactaatttgcatgcacgagcacttttgaaagtttta
ctttactatgaagtaaaatttaaacgcaagagaactttcaaaaacgctcctagaacgctt
gatttagatcttttatacttttcacaaaaagtcaagcgtgataagtggtgtgaggtgcct
cataaaggggctaaagaaagagtgagtgtaattttgcctttaggcatgatataa

DBGET integrated database retrieval system