KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj0228cHelp
Entry
Cj0228c           CDS       T00026                                 

Gene name
pcm
Definition
(RefSeq) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Brite
Enzymes [BR:cje01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Cj0228c (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 Methyltransf_32 Methyltransf_11 GCD14 Methyltr_RsmB-F Methyltransf_23 NodS Methyltransf_4 Peptidase_M17_N MTS
Motif
Other DBs
NCBI-GeneID: 906010
NCBI-ProteinID: YP_002343671
GeneDB: Cj0228c
UniProt: Q0PBS6
Position
complement(212822..213451)
Genome map
AA seq 209 aa AA seqDB search
MNAFEQKRCQNMAEEIAQKVFINEELFNAFCQIPREIFSPLKAHAYRLDALPLANSQWIS
SPLTVAKMTMALDFKNADSILEIGCGSGYQAAILSKVIRRVFTIERIENLAKKAAQTFRE
LELFNINVKFDDGQNGWKNYAPYDRILFSAYATQIPEILLDQLSDDGILVAPILHNGKQF
ITRLRKNGTNLQKEILEECLFVPIVDGKE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcatttgaacaaaaaagatgtcaaaatatggctgaagaaattgcacaaaaagtt
tttatcaatgaagaactttttaatgctttttgtcaaattccacgtgaaattttttctcct
ttaaaagcccatgcttatcgccttgatgctttgcctttagcaaattctcaatggattagt
tcacctttaactgtagctaaaatgactatggctttagattttaaaaatgctgatagtatt
ttagagataggttgtggaagtggctatcaagctgcgattttaagcaaagtcataaggcgt
gtttttaccatagaacgcatagaaaatttagccaaaaaagccgctcaaactttcagagaa
ttagaactttttaatatcaatgtaaaatttgatgatggacaaaatggctggaaaaattat
gctccttatgataggattttattttctgcttatgcgacacaaattcctgaaattttactt
gatcaattaagcgatgacggtattttagtcgctcctattttacacaatggcaaacaattc
atcacacgccttagaaaaaatggcacaaatttacaaaaagaaattttagaagaatgttta
tttgtgcctatagtagatggaaaagaataa

DBGET integrated database retrieval system