KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj0348Help
Entry
Cj0348            CDS       T00026                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cje01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cje00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cje00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
318829..320007
Genome map
AA seq 392 aa AA seqDB search
MKKAYYGDFGGQFLPESAMFALNELEGAFLKFSKDKLFKKELNELLKTYVGRPTPLYFAR
NLSKKYQHEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAETGAGQHGLATATAA
ALLGLECEIYMGATDVQRQALNVYKMELLGAKIHAVQSGLKTLKEATTAAIQAWVGDIKN
IFYVVGSAVGPYPYPKMVMHFQSIIGKECKMQLQKLNKKVDYIIAAVGGGSNAAGIFYDF
IKDENVKLIGIEAGGLGIDTPYHAATLNKGKTGIIHGMKTKVLQDDLGNILPVHSVSAGL
DYPGIGPLHAFLFESKRAQYHAISDEECMQALKLLCKEEGIIAAIESSHALAFLEKLCPT
LKKKSVIVVNLSGRGDKDMQMIRDYKKGVIYG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcgtattatggggattttggtgggcagtttttgcctgaaagtgcaatgttt
gctttaaatgagctagaaggtgcttttttgaaattttctaaagataaactctttaaaaaa
gaattaaacgagcttttaaaaacttatgtagggcgtcctactccactttattttgctaga
aatttaagcaaaaaatatcagcatgaaatttatttaaaacgcgaggatttaaatcatacc
ggagcacataaaatcaataatgccatcgctcaagcccttttagcaaaaaaaatgggaaag
aaaaaaatcatagcagaaacaggagcaggtcaacacgggcttgcaacagccactgcagca
gcacttttaggacttgaatgtgaaatttatatgggggcaaccgatgtgcaaagacaggct
ttaaatgtttataaaatggagcttttgggtgctaaaattcatgcagtacaaagtgggctt
aaaactctaaaagaagctactactgcggctattcaagcttgggttggagatattaaaaat
attttttatgtggttggaagtgcggtaggtccttatccttatcctaaaatggtaatgcat
tttcaaagtattataggaaaagaatgcaaaatgcaacttcaaaaactcaataaaaaagta
gattatattatcgcagctgttgggggtggaagcaatgcagctgggattttttatgatttt
atcaaagatgaaaatgttaaacttataggtattgaagcaggggggcttggcattgatacg
ccttatcatgcagcgactttaaataagggaaaaacaggcattattcacggtatgaaaacc
aaggttttacaagatgatttaggcaatatcttgcctgtacatagtgtttctgcagggctt
gattatccaggaattggtcctttgcatgcttttttatttgaaagcaaaagagcgcaatat
catgctataagtgatgaagaatgtatgcaggctttaaaattactttgtaaagaagaaggt
attattgcagcgattgaaagttcgcatgctttggcatttttagaaaaactttgtccaact
ttaaaaaagaaaagcgtgatagtagtaaatctttcaggcaggggagataaagatatgcaa
atgattagagattataaaaaaggggtgatttatggttga

DBGET integrated database retrieval system