KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj0358Help
Entry
Cj0358            CDS       T00026                                 

Definition
(RefSeq) cytochrome C551 peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Brite
Enzymes [BR:cje01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Cj0358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C PSCyt3
Motif
Other DBs
NCBI-GeneID: 904682
NCBI-ProteinID: YP_002343796
GeneDB: Cj0358
UniProt: Q0PBF1
Position
326024..327049
Genome map
AA seq 341 aa AA seqDB search
MKVKSLLIASLVAFSSLNAASLIDEAKNSGLVALPKDQKGVDEILKQNGVKASEFTLEKA
ELGKKLYFEPRLSKSGIISCNTCHNVGLGGTDGISTAIGHKWTANPHHLNSPTVYNAVLN
NTQFWDGRAGTLADQAKGPIQADPEMATPAKLAVEKISSLPEYVSEFKKIYGKSGVNFDN
IADAIANFERTLITPSRFDKFLEGDEKALTKEEQKGLKLFIDKGCVACHNGVNLGGNMQA
FEVAGKYKFANLGDFKGDANGMVKTPTLRNVAETAPYFHNGAIWNLKDAIKEMGSVQLGI
KISDKEAKSIETFLKSLTGTKPAIVYPQLPISTEKTPKPEL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaatcattgctaatcgcatccttagttgctttttcaagcttaaatgctgca
agtcttatagatgaagctaaaaattcaggtcttgttgccttaccaaaagatcaaaaaggc
gttgatgaaattttaaaacaaaatggagtaaaggctagtgaatttactcttgaaaaagca
gagcttggcaaaaagctctattttgaaccacgtctttcaaaaagtggtatcatttcttgt
aatacctgtcataatgtaggacttggtggaacagatggaatcagtactgcaataggtcat
aaatggacagcaaatcctcatcatttaaattcaccaacagtttataatgcagttttaaat
aatactcaattttgggatggtcgtgcaggaacattagccgatcaagctaaaggtccaatc
caagctgatcctgaaatggcaactcctgctaaacttgcagtagaaaaaatttcatctttg
cctgaatatgtgagtgagtttaaaaaaatctatggtaaaagcggtgtaaattttgacaat
attgctgatgcaattgcaaattttgaaagaactttgatcactccatctcgttttgataaa
tttttagaaggcgatgaaaaagctttaacaaaagaagaacaaaaaggcttaaagcttttt
atagataaaggttgtgtagcttgtcataatggtgtgaatttaggtggcaatatgcaagcg
tttgaagttgctggtaaatataaatttgcaaatttaggtgattttaaaggtgatgcaaat
ggcatggtaaaaactccaactttaagaaatgttgctgaaactgctccatattttcataat
ggtgcgatttggaatttaaaagatgctattaaggaaatgggtagtgtgcaacttggcatt
aaaatttctgataaagaagcaaaaagtattgaaactttcttaaaatctttaacaggaaca
aaaccagcaattgtttatccacaacttcctatttctactgaaaaaactcctaaacctgaa
ctataa

DBGET integrated database retrieval system