KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj0585Help
Entry
Cj0585            CDS       T00026                                 

Gene name
folP
Definition
(RefSeq) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
cje00790  Folate biosynthesis
cje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cje00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cj0585 (folP)
Enzymes [BR:cje01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Cj0585 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-GeneID: 904908
NCBI-ProteinID: YP_002344015
GeneDB: Cj0585
UniProt: Q0PAT2
Position
544189..545331
Genome map
AA seq 380 aa AA seqDB search
MKFFKINPNTDFNLLCSFINPHKMGQKIMSEKTKIHFIFIKDISTPAANILKQDALRVGA
ELITHKEVITAKITHSNALLMASKEQIQKLVVKEKLQDFGLKNLALFLQKDFLKPKKAEL
MAVINVNEDSFNAKSRVSEEDFEKRLNDFLALKPEYIDIGAVSSRPGSEYCGKEEEFKRL
KKVLDLIYEKNYYEQAIFSLDSFDEYCLEYALNKGFKLINDITSLRNLNLAKLASKYGAK
YCLMHMQNNPNNMQDNPFYEDLLDEMTLFFKEKLELLESFGVKESILDVGIGFGKSAGHN
MILIKHLEHFLQFNKPLLIGASRKSVINAYFQSEIKDRLAGTLYLHLKAFENGASIIRVH
DLYEHKQLFALAQAMDNIGV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttttaaaatcaatccaaacaccgattttaatttgctttgttctttcataaac
cctcataaaatgggacaaaagatcatgagtgaaaaaacaaaaattcattttatttttatc
aaagatatttctactcctgcggcaaatattttaaaacaagatgctttaagagtaggagct
gaacttattactcataaagaagtaattactgcaaaaatcactcattcaaatgcgctttta
atggcaagtaaagagcaaattcaaaagcttgttgtcaaagaaaaacttcaagattttgga
cttaaaaatttggctctttttttgcaaaaagattttttaaaaccgaaaaaagccgagctt
atggcagtgattaatgtcaatgaagacagttttaatgcaaaaagtcgtgtgagtgaagaa
gactttgaaaaaaggcttaatgactttcttgctttaaagcctgaatatatcgatataggt
gcggtaagctcaagacctgggagtgagtattgtggcaaggaagaggaatttaaaagactg
aaaaaagtacttgacttaatttatgagaaaaattattacgaacaagcaatttttagttta
gatagttttgatgaatattgtctagaatatgctttaaataagggttttaaactcattaat
gatattacaagtttaagaaatcttaatctagccaaacttgcaagtaaatatggggcaaaa
tattgcttaatgcacatgcaaaacaatccaaataacatgcaagataatcctttttatgaa
gatttgcttgatgagatgactttgttttttaaagaaaaacttgagcttttagaaagtttt
ggagtaaaagaaagtattttagatgtaggtattggttttggaaagagtgcggggcataat
atgattttaatcaaacacttagaacattttttgcaatttaataaacctttacttataggt
gcgagtcgtaaaagtgtgattaatgcgtattttcaaagcgagattaaagatcgtttagcg
ggaactttatatttgcatttaaaggcttttgaaaatggtgctagtattataagagtgcat
gatttatatgagcataaacaactttttgctttagcgcaggcaatggataatataggagtt
tag

DBGET integrated database retrieval system