KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj0799cHelp
Entry
Cj0799c           CDS       T00026                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cje00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cj0799c (ruvA)
Enzymes [BR:cje01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Cj0799c (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(749307..749858)
Genome map
AA seq 183 aa AA seqDB search
MVVGIEGIITKKEPTFIIVKCASGLSYGIFISLFCSAKIQTQEKHEFFITQIIKEDSNKF
YGFLDKDEQKMFEMLLKVNGVGANTAMAVCSSLDVNSFYKALSLGDESVLKKVPGIGPKS
AKRIIVELSDTKTKLENVSDDKSEALAALLTLGFKQEKIISVLVSAQATGTSELIKEALK
KLG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcggcatcgaaggaataatcacaaaaaaagaacctacttttatcattgttaaa
tgtgctagtggtttaagctatgggatatttatttctcttttttgttctgctaaaattcaa
actcaagaaaagcatgagttttttatcactcaaatcatcaaagaagattctaataaattt
tatggcttcttggataaagatgaacaaaaaatgtttgaaatgcttttaaaagtcaatgga
gtgggtgcaaatactgctatggcggtatgctctagtcttgatgtaaattctttttacaaa
gcgttaagtttgggcgatgaaagcgtgcttaaaaaagtacctggcataggtccaaaaagt
gcaaaacgcattatagtagaactttctgacacaaaaaccaaacttgaaaatgtaagcgat
gataaaagcgaagccttagccgcacttcttactctaggctttaaacaagaaaaaatcata
agtgttttagtaagtgctcaagcaacaggcacaagcgaactcatcaaagaagctcttaaa
aaactaggataa

DBGET integrated database retrieval system