KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj0812Help
Entry
Cj0812            CDS       T00026                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cje00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cj0812 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cj0812 (thrC)
Enzymes [BR:cje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cj0812 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
UniProt: 
Position
763071..764483
Genome map
AA seq 470 aa AA seqDB search
MKLVESRNVNNVSSFKEALINPNAPEGGLYSPLNLPIFEGEKYANLSYKDFALKLIESFG
FGEEELFKKALKSYESFDDKNTPISLQKISEKTYINELWHGPTRAFKDMALQPFGVLLSE
FSKDKNILIICATSGDTGPATLKSFENAKNVKVACMYPKGGTSGVQELQMRALDKDNLKV
FAIDEDFDAAQRTLKELLFSKDFQNEIKALNYELCAANSVNFGRILFQIIYHYYASLKLF
NEFLEEVQIIVPSGNFGNALGAFYAKKMGAKISKIKIASNANNILSEFFNQGVYDLREKS
LKKTISPAMDILISSNIERLLFAKFKDKRTKELMNLLKNERYFKLEKEELQSLQEDFEAD
FCTDEECMQFIKQSKILIDPHTATCFKMLDPLKPSIITSTAEWTKFTPSMIKALYDRDSK
NEKEDLKFIAKEFNVQVKDEILALFDLKNSDEKVFEARNIKKEILDWMQK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattggtcgagagtagaaatgtaaataatgtatcaagttttaaggaagctttgatt
aacccaaacgctccagaaggagggctttactcacctttaaatttgcctatttttgaagga
gaaaaatatgccaatttgtcttataaagattttgctttaaagcttatagaaagttttggt
tttggcgaagaagagctttttaaaaaggctttgaaaagttacgaaagctttgatgataaa
aatacacctatttctttgcaaaaaatctctgaaaaaacctatattaacgagctttggcat
gggcctacaagagcttttaaagatatggctttacagccttttggcgtgcttttaagcgaa
ttttcaaaggataaaaatattttaattatctgtgctacaagcggcgatacagggcctgca
accctaaaaagttttgaaaatgcaaaaaatgttaaagtagcttgtatgtatccaaaaggt
ggcacaagtggagttcaagagttgcaaatgcgagctttagataaggataacttgaaagtt
tttgccatagatgaggattttgacgcagcgcaacgcactttaaaagaattgcttttttca
aaagattttcaaaatgaaattaaagctttaaattatgagctttgcgcagctaattctgta
aattttgggcgtattttatttcagattatttatcattattatgcgagtttaaaacttttt
aatgagtttttagaagaagtacaaatcatcgttccaagtggaaattttggcaatgcttta
ggagctttttatgctaaaaaaatgggagctaaaatttcaaaaatcaaaatcgcttcaaac
gcaaataatattttgagtgaattttttaatcaaggcgtttatgatttgcgtgaaaaaagt
cttaagaagactatttctccagctatggatatacttatttcatctaatatcgaaagactt
ttgtttgcgaaatttaaagataaaagaactaaagaactgatgaatttgttaaaaaatgaa
agatattttaaacttgaaaaagaagaattacaaagtttgcaagaagattttgaggcggat
ttttgcaccgatgaagaatgtatgcaatttatcaaacaaagcaagattttaatcgatccg
cataccgcaacttgttttaaaatgcttgatcctttaaaacctagcattatcacttctaca
gcagaatggacaaaatttactccaagtatgataaaagctttatatgatagggattctaag
aatgaaaaagaagatttaaaatttatagctaaagagtttaatgtccaagttaaagatgaa
attttggctttatttgatttgaaaaatagcgatgaaaaggtatttgaagccagaaatata
aaaaaagaaattttagattggatgcaaaaatga

DBGET integrated database retrieval system