KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj0995cHelp
Entry
Cj0995c           CDS       T00026                                 

Gene name
hemB
Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
cje00860  Porphyrin and chlorophyll metabolism
cje01100  Metabolic pathways
cje01110  Biosynthesis of secondary metabolites
cje01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cje00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cj0995c (hemB)
Enzymes [BR:cje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Cj0995c (hemB)
Exosome [BR:cje04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cj0995c (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 905286
NCBI-ProteinID: YP_002344390
GeneDB: Cj0995c
UniProt: Q0P9Q7
Position
complement(926169..927152)
Genome map
AA seq 327 aa AA seqDB search
MFKRFRRLRLNENLRSMVRENSLSVNDLIYPLFVVNGTGIKKEISSMPDVFQMSLDEILK
ECQNVVNLGIKAIILFGVLENEKKDSCGSDALDDEGLVARSIREIKKNFPDLFIISDLCF
CEYTDHGHCGIIDPKIKSVDNDATLEISAKQALVHARAGVDMIAPSGMMDGVITTLRKAL
DKEGFENLPIMAYSTKFASSYYGPFRDVAESAPSYGDRKSYQMDFANGKEALEESLEDEA
QGADILMVKPALAYLDVVKEISLHSNLPLCIYNVSGEYAMLKAAKNAGVIDYEKVLYETI
IAFKRAGAKLIITYHAKELAKMLKGEK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagatttagaagattaaggcttaatgaaaacttaagatctatggtaagggaa
aattctttaagtgtaaatgatttgatttatccgctttttgtggttaatggaacggggata
aaaaaagaaatttcttctatgcctgatgtgtttcaaatgagtttagatgaaattttaaaa
gagtgtcaaaatgtagttaatttaggcattaaagccattatactttttggtgttttagaa
aatgagaaaaaagacagttgtggaagcgatgctttagatgatgaagggcttgttgcaaga
agtataagagagattaagaaaaattttccagatctttttataatcagtgatctttgtttt
tgcgaatacacagatcacgggcattgtgggattatcgatccaaaaataaaaagcgtagat
aatgatgcaactttagaaatttcagccaagcaagccttagttcatgcaagagcaggggta
gatatgatagcacctagtggaatgatggatggtgttatcactactttgcgcaaagcttta
gataaggaaggttttgaaaatttgcctataatggcgtattctactaaatttgcatcaagt
tattatgggccatttcgagatgtagcagagtcagctccaagttatggagatagaaaaagc
tatcaaatggattttgctaatggtaaagaagctttagaagaaagcttagaggatgaagca
caaggagctgatattttaatggtaaaacctgctcttgcttatcttgatgtggttaaagaa
atatcccttcattctaacttgcctttgtgtatttataatgtaagcggagagtatgctatg
ttaaaggcagctaaaaatgcaggagtgattgattatgaaaaagttttgtatgaaactata
atagcttttaaaagagcaggggcaaagcttatcatcacttatcatgctaaagaattagct
aaaatgttaaaaggagaaaaatga

DBGET integrated database retrieval system