KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj1048cHelp
Entry
Cj1048c           CDS       T00026                                 

Gene name
dapE
Definition
(RefSeq) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
cje00300  Lysine biosynthesis
cje01100  Metabolic pathways
cje01120  Microbial metabolism in diverse environments
cje01230  Biosynthesis of amino acids
Module
cje_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cje00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Cj1048c (dapE)
Enzymes [BR:cje01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Cj1048c (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42 Peptidase_M18 KNTase_C
Motif
Other DBs
NCBI-GeneID: 905340
NCBI-ProteinID: YP_002344443
GeneDB: Cj1048c
UniProt: Q0P9K4
Position
complement(980554..981651)
Genome map
AA seq 365 aa AA seqDB search
MNAKEFLIELLKFKSVTPNDDGALNFIAMELSDFEAFFIEKEGIKNLLLTKKFKDEGEHL
AFGGHVDVVPAGEGWSNNAFAPVEKEGFIYARGAQDMKSGVAAFVDAAKNADFKGARLSL
ILTSDEEGEAIYGTKAVLEWMQERDMLPDYAVVAEPTCVKKIGDSIKIGRRGSINGKLLI
RGKQGHVAYPEKCINPVHDFAPVLKLLAGFDLDPGSAEFSPSKIVITDIRGGMGVCNVTP
NDLKLMFNVRNSPDTSLEDVKSYVEKICHGLNYELELKQSSEAFLTNIDNKIVQKMNESV
QKITHEVPELNTKGGTSDARYFAKYGVKVVEFGVCNDRIHAIDERVSIEEFEKLCLVFKD
LIENF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaaagaatttttaatcgaacttttaaaatttaaatctgttacgccaaatgat
gatggagctttaaatttcatcgctatggaactgagtgattttgaagctttttttatagaa
aaagaaggcattaaaaaccttttactcactaaaaaatttaaagatgaaggcgagcattta
gcttttggtgggcatgtagatgtggtgcctgcaggcgagggttggagtaataatgctttt
gcgcctgtggaaaaagaaggctttatctatgcaaggggtgctcaagatatgaaaagcgga
gtagcagcctttgtggatgcggcaaagaatgcggattttaaaggagcaagactgagtctt
attttaacaagtgatgaagaaggcgaggctatatatggaaccaaggctgttttagaatgg
atgcaagaaagagatatgttacctgattatgccgtggttgcagagccaacctgtgttaaa
aaaatcggcgatagtattaaaatagggcgtcgtggttctatcaatggaaaacttttaatc
cgtggaaaacaagggcatgttgcttatcctgaaaaatgtatcaatcctgtgcatgatttt
gcaccggttttaaagcttttagcgggttttgatcttgatcctggaagtgctgaatttagt
ccttcaaaaatcgttataactgatattcgtggaggtatgggggtatgtaatgtaacgcca
aatgatttaaaacttatgtttaatgtacgcaattcccctgatacaagcttagaagatgta
aaaagttatgtagaaaaaatttgtcatggtttaaactatgagttagagctaaaacaatca
agcgaagcttttttgacaaatatcgataataaaatcgttcaaaaaatgaatgaaagcgtt
caaaaaatcactcatgaagtgccagagcttaataccaaaggcggtacaagtgatgcaagg
tattttgcaaaatacggtgtaaaggtagtagaatttggggtttgtaatgatagaattcac
gctattgatgaaagagtaagcatagaagaatttgaaaaactttgccttgtttttaaagac
ttgatagaaaatttttaa

DBGET integrated database retrieval system