KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj1104Help
Entry
Cj1104            CDS       T00026                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cje00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1038334..1039101
Genome map
AA seq 255 aa AA seqDB search
MKAYAKANIFLKLTGFDSRKYHLLESRFILLKDVFDELELVDKESDSKKEFEIISNFKCE
NNIIQKAYLLLSRRYNNELKELFSKKSLKLTKNIPVCAGLGGGSSDCASFLLLINETLNL
KLNLQELINLSIQLGSDIAFFLSGFHSANVSSCGEIIEEFEDDIPNLKWTFPQISCQTKA
VYDEFDRGIFDFQKNNNQAQIYKKLSTKELLQNFKNKELNDLFTPCATLYPKMKSYLQED
FFLSGSGSSVFKVDR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttacgctaaagcaaatatttttttaaaacttaccggttttgactcaagaaaa
tatcatcttttagaatcacgatttatacttttaaaagatgtttttgatgagcttgagctt
gttgacaaagaatcagattctaaaaaagaatttgaaatcattagtaattttaaatgcgaa
aataatattattcaaaaggcttatttgctactttctagaagatataataacgaattaaaa
gaattatttagcaaaaaaagtctaaaactcacaaaaaatatcccagtatgtgctgggctt
ggtggtggaagtagcgattgtgcgagttttttactactaataaatgaaaccctaaattta
aaattaaacctacaagaacttataaatttaagcatacaactaggaagtgatattgccttt
tttttaagtggctttcactctgctaatgtaagtagctgtggcgaaattatagaagaattt
gaagatgacatacctaatttaaaatggacttttccacaaatatcttgccaaactaaagct
gtttatgatgaatttgatagaggaatatttgactttcaaaaaaacaataatcaagcgcaa
atctacaaaaaactcagcacaaaagagttgttacaaaactttaaaaacaaagaattaaat
gatttatttactccttgtgcaactttatatcctaaaatgaagtcttacttgcaagaagat
ttttttctaagcggtagcggtagtagtgtttttaaggttgatcgatga

DBGET integrated database retrieval system