KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj1155cHelp
Entry
Cj1155c           CDS       T00026                                 

Definition
cation-transporting ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(1085907..1088264)
Genome map
AA seq 785 aa AA seqDB search
MIMKCEHCKLDYKQAQMIEYKGKFFCCKGCESVWEILHESGLDEFYEKLGNQTLSPVNFQ
NEMKNYDEFITKTKEGFSEIYLMIHGIECAACVWLNEKILTKQEGILELDINHLNHKARI
VFDEQSISLVQILRLIESIGYKASAYDASKASKKADLLKREFYSKLVVAIACVMNIMWIA
VAKYAGFFSGMDKDTKDILNFAEFILCSPVLFYTGSHFYKSAFKTLKMHSLNMDVLVISG
ASLAYVYSLWAMFFRVGEVYFDSVAMIICFVFIGKYLEMFSKKRALDTIDGLNDFLQNEV
LVFNGKEFVSKEVQKVCLGDRILLKTGDKILIDGICKSGEMSVDTSSLNGENTPKLIQKE
DEIFSACIVLDGSVEYEATKFYKDSKLSQIIQLLELASSKKAKLESLVNSLLAYFSRTVL
LIAFICFAFWFFYKEESFEISLVNAIAVLIIACPCALALATPVSNLVALGRALKKHILFK
SSSVIEDLSKCDCVVFDKTGILTKIELELKEVFLDKALDLNELYNFVKLSKHPISQNIVL
YLKQKGAKDLNLDFKKHSSIQAKGLSAELNEGLLLGGSSKFLQEKGIVAKEFDNTHFIFA
KEGKILAFFEFDSVLREGAKELIAYLKKEKKELMILSGDHQKAVEKIAKKLEIQNYQASC
LPEDKMKTIENLSKNYKVLFVGDGVNDALALKYASVSMTLREGSDLAIESSDVLLLKNDL
LSLKKAIKLSKNTFKIIKQNLAFSLFYNACTIPLAFLGMINPLFAAISMSFSSIIVVLNA
LRIKE
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgattatgaaatgtgaacattgcaaacttgattataaacaagcccaaatgatagagtat
aagggtaaatttttttgttgtaaaggttgtgagagcgtttgggaaattttgcatgaaagt
ggattagatgagttttatgaaaagcttggaaatcaaactttaagccctgtaaattttcaa
aatgaaatgaaaaattatgatgagtttatcactaaaaccaaagaaggatttagtgaaatt
tatctcatgatacacggtatagaatgtgcagcttgtgtgtggcttaatgagaaaatttta
accaaacaagaaggaattttagaacttgatattaatcatttaaaccataaagcacgcatt
gtttttgatgagcaaagcatttctttggtgcaaattttaagacttattgaaagcataggc
tataaagcgagtgcttatgatgcgagcaaggcttcaaaaaaagcggatttactaaaaagg
gaattttattctaagcttgttgtggctatagcttgtgtgatgaatatcatgtggatagca
gtggcaaaatacgcaggattttttagcggtatggataaggacactaaggatattttaaat
tttgctgaatttatcctttgttctcctgtgcttttttatacgggatctcatttttataaa
agtgcttttaaaactttaaaaatgcatagtttaaatatggatgtattggtgattagcgga
gcgagtttggcttatgtttattctttatgggccatgttttttagggtaggggaggtgtat
tttgactctgtggcgatgataatttgctttgtttttataggtaaatatcttgagatgttt
agcaaaaagcgtgctttagatactatagatgggcttaatgattttttgcaaaatgaagtt
ttagttttcaatggtaaagaatttgtctctaaagaagtgcaaaaggtttgtttgggggat
agaattttgcttaaaactggagataaaattttaatcgatgggatttgtaaaagtggtgaa
atgagcgtagatacttcttctttaaatggagaaaataccccaaaactcatacaaaaagaa
gatgaaattttttcagcttgtatagtgcttgatggaagtgtggagtatgaagcaacaaag
ttttacaaggattcaaaactcagtcaaattatccagcttttagaacttgcaagttctaaa
aaagcaaaacttgaaagtttggtcaatagtcttttggcttatttttctagaacggtttta
ttgatcgcttttatttgttttgctttttggtttttttataaagaagagagtttcgaaatt
tctttagtcaatgcgattgcagttttgattatcgcttgtccttgtgctttggctttagca
acgccagtgagcaatcttgtggctttaggtagggctttaaaaaagcatattttatttaaa
agttctagcgtgatagaagatttaagcaaatgtgattgtgtggtgtttgataaaacgggt
attttaaccaaaatagagcttgaacttaaagaggtttttttagataaagcgcttgattta
aacgagctttataattttgtaaaactttctaaacatcctatctctcaaaatattgtgtta
tatttaaagcaaaaaggagctaaggatttaaatttggattttaaaaagcattcgagtatt
caagctaaaggtttaagtgctgagttaaatgaagggttgcttttaggcggaagttctaaa
tttttgcaagaaaagggtattgtggctaaagaatttgataatacgcattttatttttgcc
aaggaaggtaaaattttagctttttttgagtttgatagtgttttaagagaaggtgcaaaa
gagcttatcgcttatcttaaaaaagaaaagaaagaattaatgatactcagtggcgatcat
caaaaagcagtggaaaaaatcgctaaaaagttagaaattcaaaattatcaagcttcttgt
ttgcctgaagataagatgaaaactatagaaaatttaagtaaaaattacaaagttttattt
gtaggtgatggggtaaatgatgcactagctttaaaatacgcaagtgtttcaatgacttta
agagaaggaagtgatctagctatagaaagtagtgatgttttgcttttgaaaaatgacttg
ctttctttaaaaaaagccatcaaattatctaaaaacacctttaaaattatcaagcaaaat
cttgctttttctttgttttataatgcttgcaccatacctttggcttttttgggtatgata
aatcctttatttgctgctatttctatgtcttttagtagtataatagtcgttttaaatgct
ttaaggattaaagaatga

DBGET integrated database retrieval system