KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj1346cHelp
Entry
Cj1346c           CDS       T00026                                 

Gene name
dxr
Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
cje00900  Terpenoid backbone biosynthesis
cje01100  Metabolic pathways
cje01110  Biosynthesis of secondary metabolites
cje01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cje00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cj1346c (dxr)
Enzymes [BR:cje01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Cj1346c (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-GeneID: 905638
NCBI-ProteinID: YP_002344734
GeneDB: Cj1346c
UniProt: Q9PMV3
Position
complement(1278851..1279921)
Genome map
AA seq 356 aa AA seqDB search
MILFGSTGSIGVNALKLAALKNIPISALACGDNIALLNEQIARFKPKFVSIKDSKNKHLV
KHDRVFIGQEGLEQILTECQDKLLLNAIVGFAGLKSTLKAKELGKNIALANKESLVVAGS
FLKGAKFLPVDSEHAALKFLLEGKKNIAKLYITASGGAFYRYKIKDLNQVSVKDALKHPN
WNMGAKITIDSATMANKLFEIIEAYHLYDFKEIDALIEPRSLVHAMCEFKNGASTAYFSK
ADMKLAISDAIFEKQDTPILEAVDFSKMPALKFHPISTKKYPIFKLKNTFLKEPNLGVII
NAANEVGVYNFLENKSGFLDIAKCIFKALDHFGVPKISSIEEVFEYDFKTREYLRS
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgatactttttggaagtacgggcagtataggagtaaatgctcttaaacttgctgcttta
aaaaacattcccatttctgctttagcttgtggggataacatcgctcttttaaatgagcaa
atcgcaaggtttaaacccaaatttgtttccataaaagattcaaaaaataagcatttagtt
aaacacgatagagtttttatagggcaagaaggtttagagcaaattttaacagaatgtcaa
gataagcttttactcaatgccattgtaggttttgcaggacttaaaagcactttaaaggct
aaagagcttggcaaaaacatagctttagctaacaaagaaagtcttgtagtagctgggagt
tttttgaaaggggctaaatttttacccgttgatagtgagcatgcagctttaaaattttta
ctcgaaggtaaaaaaaatatagcaaaactttatatcacagcaagtggtggagctttttat
aggtataaaatcaaagatttaaatcaagtcagtgtcaaagatgctttaaaacatcctaat
tggaacatgggagcaaagatcactatagatagtgcgactatggcaaataagctttttgag
attatagaggcttatcatttatatgattttaaagaaattgatgctttaatagaaccaaga
tctttagtgcatgcaatgtgtgaatttaaaaatggagctagcacggcgtatttttcaaaa
gcagatatgaaactagctatttcagatgctatatttgaaaaacaagatacgcctatttta
gaggctgttgattttagcaaaatgcctgctttaaaatttcatccaatcagcacaaaaaaa
tatcctatttttaagcttaaaaatacatttttaaaagagccaaatttaggtgttatcatc
aatgctgctaatgaagttggtgtttataattttttagaaaataaaagtggatttttagac
attgctaaatgcatttttaaagcccttgatcattttggagtacctaaaatttcaagcata
gaagaagtttttgagtatgattttaaaacaagagagtatttaaggagttaa

DBGET integrated database retrieval system