KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj1351Help
Entry
Cj1351            CDS       T00026                                 

Gene name
pldA
Definition
(RefSeq) phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
cje00564  Glycerophospholipid metabolism
cje00565  Ether lipid metabolism
cje00592  alpha-Linolenic acid metabolism
cje01100  Metabolic pathways
cje01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cje00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Cj1351 (pldA)
   00565 Ether lipid metabolism
    Cj1351 (pldA)
   00590 Arachidonic acid metabolism
    Cj1351 (pldA)
   00591 Linoleic acid metabolism
    Cj1351 (pldA)
   00592 alpha-Linolenic acid metabolism
    Cj1351 (pldA)
Enzymes [BR:cje01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Cj1351 (pldA)
    3.1.1.32  phospholipase A1
     Cj1351 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1 TPR_7 Aida_N MIT TPR_2 TPR_6 DUF627 TPR_1 TPR_8
Motif
Other DBs
NCBI-GeneID: 905643
NCBI-ProteinID: YP_002344739
GeneDB: Cj1351
UniProt: Q0P8Q8
Position
1282933..1283922
Genome map
AA seq 329 aa AA seqDB search
MRKIALFLSLCVFIWASDLQQALEYEKQGDYKKAMEIYKKLALKNSSVLISQEQNNSSQA
TQTQNSITIKKEEKQDFSRLALANYLGENESFNPLGISSYKMNYFLPFAYSFNSLGVNNN
KSEAKFQLSVKKRLFENLLGLDEKYYIAYTQTSWWQIYEHSSPFRETNYQPEFFIDLPLY
LKDYEFFNNLRVGILHESNGKGDENLQSRSWNRIYVSTAILYNKFLFVPRLWYRIPENKK
DDDNPAILHYMGNFDVNLAYLGDDYFINLMLRNNLKFHNNKGAIQVDLGYDIFNNGIYWY
LQYFNGYGESLIDYNKHLQRLSTGFLISY
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgctttatttttaagcttatgcgtttttatatgggctagtgatttacaa
caagctttagagtatgaaaaacaaggcgattataaaaaagctatggaaatttacaaaaaa
ctcgctttaaaaaattcatctgttttgatttctcaagaacaaaataactcaagtcaagca
acacaaacgcaaaattctatcactataaaaaaagaagaaaaacaagacttttctcgctta
gctttggctaattatcttggtgaaaatgaaagctttaatccccttggcattagctcttat
aagatgaattattttttaccttttgcttatagttttaattctttaggagtaaataataat
aagagtgaggcgaaattccaacttagtgttaaaaaaagactttttgaaaatttactagga
ctagatgaaaaatattatatagcctatactcaaacttcttggtggcaaatttatgagcat
tcttctccttttagagaaaccaactatcaaccagaattttttatagatcttcctttatat
cttaaagattatgaattttttaacaatctacgcgtaggtatattgcatgaaagcaatggc
aagggagatgagaatttacaatctcgctcatggaatagaatttatgtatctactgctatt
ttatataataaatttttatttgttccacgcctttggtatagaattcctgaaaacaaaaaa
gatgatgataatcctgccatcttgcattatatgggaaattttgatgtgaatttagcgtat
ttaggtgatgattattttatcaatcttatgctaagaaataatcttaaattccacaataac
aaaggcgctatacaagttgatctaggatatgatatttttaataacggaatttattggtat
ttacaatactttaatggctatggagaaagccttatagactataacaaacacttgcaaaga
ctttccactggatttttgatttcttactaa

DBGET integrated database retrieval system