KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj1536cHelp
Entry
Cj1536c           CDS       T00026                                 

Gene name
galU
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
cje00040  Pentose and glucuronate interconversions
cje00052  Galactose metabolism
cje00500  Starch and sucrose metabolism
cje00520  Amino sugar and nucleotide sugar metabolism
cje01100  Metabolic pathways
cje01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cje00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Cj1536c (galU)
   00052 Galactose metabolism
    Cj1536c (galU)
   00500 Starch and sucrose metabolism
    Cj1536c (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    Cj1536c (galU)
Enzymes [BR:cje01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Cj1536c (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-GeneID: 905818
NCBI-ProteinID: YP_002344908
GeneDB: Cj1536c
UniProt: Q0P889
Position
complement(1467503..1468327)
Genome map
AA seq 274 aa AA seqDB search
MLQTCIFPAAGYGTRFLPATKTLPKEMLPILTKPLIHYGVDEALEAGMENMGFVTGRGKR
ALEDYFDISYELEHQISGTKKEYLLDEIRSLINRCTFTFTRQNQMKGLGDAVLKGRPLVG
DEAFGVILADDLCVNEEGLNVMAQMVKIYEKYRCTIIAVMEVPKEQVSNYGVISGNFVEE
NLIMVNSMIEKPSPDEAPSNLAIIGRYILTPDIFGILENTKAGKNGEIQLTDALLTQATN
GMVLAYKFQGKRFDCGSVEGFVEATNYFYEKSKC
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaacttgtattttccctgcggcaggttatgggacgagatttttacctgcaaca
aaaactttacctaaagagatgttacctatcttaaccaagcctttgatccattatggagtt
gatgaagctttagaagcaggaatggaaaatatgggatttgtcacagggcgtggaaaaaga
gctttggaggattattttgatatttcttatgaacttgaacatcaaatttcaggtacaaaa
aaagaatacttacttgatgaaattcgctctttgatcaatcgttgtacctttacttttaca
agacaaaatcaaatgaaaggcttaggtgatgcggttttaaaaggtagacctttggttggc
gatgaagcttttggcgtaattttggctgatgatttgtgtgttaatgaagaaggcttaaat
gttatggctcaaatggtaaaaatttatgaaaaatatcgctgcaccatcatagctgtgatg
gaagtaccaaaagagcaagtttcaaactatggagtaatttctggaaattttgtagaagaa
aatcttatcatggttaattctatgatagaaaaaccaagtcctgatgaagctccaagtaat
cttgctatcataggaagatatattttaactcctgatatttttggaattttagaaaatact
aaagcaggaaaaaatggtgaaattcaacttaccgacgcgcttttaactcaagcaaccaat
ggtatggttttagcttataaatttcaagggaaacgctttgattgtggaagtgtagaaggc
tttgtagaggcgacaaattatttttacgagaaaagtaaatgttaa

DBGET integrated database retrieval system