KEGG   Campylobacter jejuni subsp. jejuni 00-2425: N135_00097Help
Entry
N135_00097        CDS       T02844                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cjei  Campylobacter jejuni subsp. jejuni 00-2425
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cjei00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    N135_00097 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    N135_00097 (proB)
Enzymes [BR:cjei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     N135_00097 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
106662..107417
Genome map
AA seq 251 aa AA seqDB search
MKRIVVKVGSHVISEENTLSFERLKNLVAFLAKLMEKYEVILVTSAAISAGHTKLDIDRK
NLINKQVLAAIGQPFLISVYNELLAKFNKLGGQILLTGKDFDSRKATKHAKNAIDMMINL
GILPIINENDATAIEEIVFGDNDSLSAYATHFFDADLLVILSDIDGFYDKNPSEFSDAKR
LEKITHIKEEWLQATIKTGSEHGTGGIVTKLKAAKFLLEHNKKMFLASGFDLSVAKTFLL
EDKQIGGTLFE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatagttgttaaagtgggttctcatgtgattagcgaagaaaacactttaagt
tttgagcgtcttaaaaatttagtcgcatttttagctaaactcatggaaaaatatgaagta
attttagtaacctcggcggctatttcggcaggacacaccaaactagatatcgatagaaaa
aaccttattaataaacaagttttagctgctattggacaaccttttttaatcagtgtttat
aacgagcttttagccaaatttaacaaactaggcggacaaattttacttacaggcaaggat
tttgactctagaaaagctactaaacacgcaaaaaatgctatcgatatgatgataaattta
ggaattttgcctattatcaatgaaaatgacgctacagctatagaagaaattgtctttggt
gataatgatagtttaagtgcttatgctacgcatttttttgatgcggatttgcttgtgatt
ttaagcgatattgatggattttacgataaaaatcctagtgaatttagtgatgcaaagcgt
ttagaaaaaatcactcatattaaagaagaatggctacaagcaaccataaaaacaggtagt
gagcacggaacaggtggtatagtaaccaaacttaaggcagctaaatttttacttgaacac
aataaaaaaatgtttttagcaagtggctttgatttaagtgtggcaaagacatttttatta
gaagataaacaaataggtggaactttgtttgagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system