KEGG   Campylobacter jejuni subsp. jejuni 00-2544: N755_00089Help
Entry
N755_00089        CDS       T02843                                 

Gene name
proB
Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cjen  Campylobacter jejuni subsp. jejuni 00-2544
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cjen00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    N755_00089 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    N755_00089 (proB)
Enzymes [BR:cjen01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     N755_00089 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
100612..101367
Genome map
AA seq 251 aa AA seqDB search
MKRIVVKVGSHVISEENTLSFERLKNLVAFLAKLMEKYEVILVTSAAISAGHTKLDIDRK
NLINKQVLAAIGQPFLISVYNELLAKFNKLGGQILLTGKDFDSRKATKHAKNAIDMMINL
GILPIINENDATAIEEIVFGDNDSLSAYATHFFDADLLVILSDIDGFYDKNPSEFSDAKR
LEKITHIKEEWLQATIKTGSEHGTGGIVTKLKAAKFLLEHNKKMFLASGFDLSVAKTFLL
EDKQIGGTLFE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatagttgttaaagtgggttctcatgtgattagcgaagaaaacactttaagt
tttgagcgtcttaaaaatttagtcgcatttttagctaaactcatggaaaaatatgaagta
attttagtaacctcggcggctatttcggcaggacacaccaaactagatatcgatagaaaa
aaccttattaataaacaagttttagctgctattggacaaccttttttaatcagtgtttat
aacgagcttttagccaaatttaacaaactaggcggacaaattttacttacaggcaaggat
tttgactctagaaaagctactaaacacgcaaaaaatgctatcgatatgatgataaattta
ggaattttgcctattatcaatgaaaatgacgctacagctatagaagaaattgtctttggt
gataatgatagtttaagtgcttatgctacgcatttttttgatgcggatttgcttgtgatt
ttaagcgatattgatggattttacgataaaaatcctagtgaatttagtgatgcaaagcgt
ttagaaaaaatcactcatattaaagaagaatggctacaagcaaccataaaaacaggtagt
gagcacggaacaggtggtatagtaaccaaacttaaggcagctaaatttttacttgaacac
aataaaaaaatgtttttagcaagtggctttgatttaagtgtggcaaagacatttttatta
gaagataaacaaataggtggaactttgtttgagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system