KEGG   Campylobacter jejuni subsp. jejuni IA3902: CJSA_0322Help
Entry
CJSA_0322         CDS       T01854                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cji  Campylobacter jejuni subsp. jejuni IA3902
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cji00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CJSA_0322 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CJSA_0322 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CJSA_0322 (trpB)
Enzymes [BR:cji01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CJSA_0322 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
323492..324670
Genome map
AA seq 392 aa AA seqDB search
MKKAYYGDFGGQFLPESAMFALNELEGAFLKFSKDKLFKKELNELLKTYVGRPTPLYFAR
NLSKKYQHEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAETGAGQHGLATATAA
ALLGLECEIYMGATDVQRQALNVYKMELLGAKIHAVQSGLKTLKEATTAAIQAWVGDIKN
IFYVVGSAVGPYPYPKMVMHFQSIIGKECKMQLQKLNKKVDYIIAAVGGGSNAAGIFYDF
IKDENVKLIGIEAGGLGIDTPYHAATLNKGKTGIIHGMKTKVLQDDLGNILPVHSVSAGL
DYPGIGPLHAFLFESKRAQYHAISDEECMQALKLLCKEEGIIAAIESSHALAFLEKLCPT
LKKKSVIVVNLSGRGDKDMQMIRDYKKGVIYG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcgtattatggggattttggtgggcagtttttgcctgaaagtgcaatgttt
gctttaaatgagctagaaggtgcttttttgaaattttctaaagataaactctttaaaaaa
gaattaaacgagcttttaaaaacttatgtagggcgtcctactccactttattttgctaga
aatttaagcaaaaaatatcagcatgaaatttatttaaaacgcgaggatttaaatcatacc
ggagcacataaaatcaataatgccatcgctcaagcccttttagcaaaaaaaatgggaaag
aaaaaaatcatagcagaaacaggagcaggtcaacacgggcttgcaacagccactgcagca
gcacttttaggacttgaatgtgaaatttatatgggggcaaccgatgtgcaaagacaggct
ttaaatgtttataaaatggagcttttgggtgctaaaattcatgcagtacaaagtgggctt
aaaactctaaaagaagctactactgcggctattcaagcttgggttggagatattaaaaat
attttttatgtggttggaagtgcggtaggtccttatccttatcctaaaatggtaatgcat
tttcaaagtattataggaaaagaatgcaaaatgcaacttcaaaaactcaataaaaaagta
gattatattatcgcagctgttgggggtggaagcaatgcagctgggattttttatgatttt
atcaaagatgaaaatgttaaacttataggtattgaagcaggggggcttggcattgatacg
ccttatcatgcagcgactttaaataagggaaaaacaggcattattcacggtatgaaaacc
aaggttttacaagatgatttaggcaatatcttgcctgtacatagtgtttctgcagggctt
gattatccaggaattggtcctttgcatgcttttttatttgaaagcaaaagagcgcaatat
catgctataagtgatgaagaatgtatgcaggctttaaaattactttgtaaagaagaaggt
attattgcagcgattgaaagttcgcatgctttggcatttttagaaaaactttgtccaact
ttaaaaaagaaaagcgtgatagtagtaaatctttcaggcaggggagataaagatatgcaa
atgattagagattataaaaaaggggtgatttatggttga

DBGET integrated database retrieval system