KEGG   Campylobacter jejuni subsp. jejuni IA3902: CJSA_0469Help
Entry
CJSA_0469         CDS       T01854                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cji  Campylobacter jejuni subsp. jejuni IA3902
Pathway
cji00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cji01100  Metabolic pathways
cji01110  Biosynthesis of secondary metabolites
cji01130  Biosynthesis of antibiotics
cji01230  Biosynthesis of amino acids
Module
cji_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cji00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CJSA_0469 (trpC)
Enzymes [BR:cji01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CJSA_0469 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C AEP1
Motif
Other DBs
NCBI-ProteinID: ADC28118
Structure
PDB: 

Jmol
Position
467494..468270
Genome map
AA seq 258 aa AA seqDB search
MILDKIFEKTKEDLKERKLKLPYDMLGRSLASNPFFPKDVIKALKRVEKEVKIIAEVKKA
SPSKGVIREDFDPLSIALNYEKNKAAAISVLTEPHFFKGSLEYLSLIRRYTQIPLLRKDF
IFDEYQILEALVYGADFVLLIAKMLSMKELKKLLEFARHLGLEALVEIHDKEDLSKAIFA
GADIIGINHRNLEDFTMDMSLCEKLIPQIPNSKIIIAESGLENKEFLEHLQNLGVDAFLI
GEYFMREKDEGKALKALL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatattggataaaatttttgaaaaaacaaaagaagatttaaaagaacgcaaactaaaa
cttccttatgatatgttagggcgttctttagcttcaaatcctttctttccaaaagatgtg
attaaggctttaaaaagagtagaaaaagaagttaaaatcatagcagaagtaaaaaaagca
agccctagcaagggagtcattagagaagactttgatcctttgagtatcgctttaaattat
gagaagaacaaagctgcggcgatttctgttttaactgagccgcatttttttaaaggttct
ttagaatacttaagtcttatacgccgttatacgcaaattcctttacttagaaaagatttt
atctttgatgagtatcaaattttagaagctttggtttatggggcggattttgtattatta
atcgctaaaatgctaagcatgaaagagcttaaaaaactgcttgagtttgcaagacattta
ggtcttgaggctttggttgaaatccatgataaagaggatttgagtaaggctatttttgct
ggagcggatattatcggtatcaatcatcgtaatttagaggattttactatggatatgagt
ttgtgcgaaaaacttatcccacaaatcccaaattcaaaaatcatcatcgcagaaagtggt
ttagaaaataaagaatttttagagcatttgcaaaatttaggcgttgatgcttttttaatc
ggcgaatattttatgcgcgaaaaagatgaaggaaaggctttaaaagctttgctttaa

DBGET integrated database retrieval system