KEGG   Campylobacter jejuni subsp. jejuni IA3902: CJSA_0938Help
Entry
CJSA_0938         CDS       T01854                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cji  Campylobacter jejuni subsp. jejuni IA3902
Pathway
cji00860  Porphyrin and chlorophyll metabolism
cji01100  Metabolic pathways
cji01110  Biosynthesis of secondary metabolites
cji01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cji00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CJSA_0938 (hemB)
Enzymes [BR:cji01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CJSA_0938 (hemB)
Exosome [BR:cji04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CJSA_0938 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ADC28577
Position
complement(929037..930020)
Genome map
AA seq 327 aa AA seqDB search
MFKRFRRLRLNENLRSMVRENSLSVNDLIYPLFVVNGTGIKKEISSMPDVFQMSLDEILK
ECQNVVNLGIKAIILFGVLENEKKDSCGSDALDDEGLVARSIREIKKNFPDLFIISDLCF
CEYTDHGHCGIIDPKIKSVDNDATLEISAKQALVHARAGVDMIAPSGMMDGVITTLRKAL
DKEGFENLPIMAYSTKFASSYYGPFRDVAESAPSYGDRKSYQMDFANGKEALEESLEDEA
QGADILMVKPALAYLDVVKEISLHSNLPLCIYNVSGEYAMLKAAKNAGVIDYEKVLYETI
IAFKRAGAKLIITYHAKELAKMLKGEK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagatttagaagattaaggcttaatgaaaacttaagatctatggtaagggaa
aattctttaagtgtaaatgatttgatttatccgctttttgtggttaatggaacggggata
aaaaaagaaatttcttctatgcctgatgtgtttcaaatgagtttagatgaaattttaaaa
gagtgtcaaaatgtagttaatttaggcattaaagccattatactttttggtgttttagaa
aatgagaaaaaagacagttgtggaagcgatgctttagatgatgaagggcttgttgcaaga
agtataagagagattaagaaaaattttccagatctttttataatcagtgatctttgtttt
tgcgaatacacagatcacgggcattgtgggattatcgatccaaaaataaaaagcgtagat
aatgatgcaactttagaaatttcagccaagcaagccttagttcatgcaagagcaggggta
gatatgatagcacctagtggaatgatggatggtgttatcactactttgcgcaaagcttta
gataaggaaggttttgaaaatttgcctataatggcgtattctactaaatttgcatcaagt
tattatgggccatttcgagatgtagcagagtcagctccaagttatggagatagaaaaagc
tatcaaatggattttgctaatggtaaagaagctttagaagaaagcttagaggatgaagca
caaggagctgatattttaatggtaaaacctgctcttgcttatcttgatgtggttaaagaa
atatctcttcattctaacttgcctttgtgtatttataatgtaagcggagagtatgctatg
ttaaaggcagctaaaaatgcaggagtgattgattatgaaaaagttttgtatgaaactata
atagcttttaaaagagcaggggcaaagcttatcatcacttatcatgctaaagaattagct
aaaatgttaaaaggagaaaaatga

DBGET integrated database retrieval system