KEGG   Campylobacter jejuni subsp. jejuni IA3902: CJSA_1332Help
Entry
CJSA_1332         CDS       T01854                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cji  Campylobacter jejuni subsp. jejuni IA3902
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cji00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CJSA_1332 (tpiA)
   01230 Biosynthesis of amino acids
    CJSA_1332 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJSA_1332 (tpiA)
   00051 Fructose and mannose metabolism
    CJSA_1332 (tpiA)
   00562 Inositol phosphate metabolism
    CJSA_1332 (tpiA)
Enzymes [BR:cji01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CJSA_1332 (tpiA)
Exosome [BR:cji04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CJSA_1332 (tpiA)
  Exosomal proteins of bladder cancer cells
   CJSA_1332 (tpiA)
  Exosomal proteins of melanoma cells
   CJSA_1332 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1340706..1341377)
Genome map
AA seq 223 aa AA seqDB search
MIFAANLKCNHTRASFKIYAKILNKTMGVKCDDIIVFPPSIAFLENENNFIQGAQNFYPC
VNGAFTGELGKEHLDEFGIKCVLIGHSERRALGDEEFIKAKFDFAKEHGYKIVFCIGENL
DTKNSGKTLEFLKKQLEIIDLNYEKLIIAYEPIYSIGTGVSAQSTDIAKVLEFLASLTKV
PLLYGGSVNENNIKEILSVNHCGGVLIGSAALKVENFIKLIKG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatctttgctgcaaatttaaaatgcaatcacacaagagcaagctttaaaatttatgct
aaaattttaaataaaactatgggggtaaaatgcgatgatattatcgtttttccacctagt
atagcatttttagaaaatgaaaataacttcatacaaggagcgcaaaatttttatccttgt
gttaatggtgcttttacaggcgagcttggaaaagaacatttggacgaatttgggattaaa
tgtgtcttaatcgggcattctgaaagaagagctttaggagatgaagaatttattaaggct
aaatttgattttgctaaagagcatggttataaaattgttttttgtataggtgaaaattta
gatacaaaaaattcaggcaagactttagagtttttaaaaaaacaacttgaaattattgat
ttaaattatgaaaaactcatcatcgcttatgagcctatttattctataggaacgggagtg
agcgcacaaagtacagatatcgctaaagtgcttgaatttttagcgagtttaaccaaagta
cctttgctttatggtggaagtgtgaatgaaaataatatcaaagaaattttaagtgtaaat
cattgtggtggagttttgataggctctgcagctttaaaagtagaaaattttataaaatta
atcaaaggataa

DBGET integrated database retrieval system